Camkii PowerPoint PPT Presentations

All Time
Show:
Recommended
Sort by:
Indicating CaMKII in AMPA Receptor Phosphorylation PowerPoint PPT Presentation
Indicating CaMKII in AMPA Receptor Phosphorylation - ... effect on STP but attenuated LTP and blocked enhanced ... CamKII inhibition attenuates synaptic potentiation after 5-10 min. A Look Ahead (if you dare) ...
... effect on STP but attenuated LTP and blocked enhanced ... CamKII inhibition attenuates synaptic potentiation after 5-10 min. A Look Ahead (if you dare) ...
| PowerPoint PPT presentation | free to view
An Important Role of Neural Activity-Dependent CaMKIV Signaling in the Consolidation of Long-Term Memory PowerPoint PPT Presentation
An Important Role of Neural Activity-Dependent CaMKIV Signaling in the Consolidation of Long-Term Memory - An Important Role of Neural Activity-Dependent CaMKIV Signaling in the ... Western Blot: Flag: transgene expression in hippocampal extracts ...
An Important Role of Neural Activity-Dependent CaMKIV Signaling in the ... Western Blot: Flag: transgene expression in hippocampal extracts ...
| PowerPoint PPT presentation | free to download
Why do we care about a sequence alignment PowerPoint PPT Presentation
Why do we care about a sequence alignment - worm CaMKII EARICRKLQHPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQI ... worm CaMKII LESIAYCHSNGIVHRDLKPENLLLASKAKGAAVKLADFGLAIEVN-DSEAWHGFAGTPGY ...
worm CaMKII EARICRKLQHPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQI ... worm CaMKII LESIAYCHSNGIVHRDLKPENLLLASKAKGAAVKLADFGLAIEVN-DSEAWHGFAGTPGY ...
| PowerPoint PPT presentation | free to view
Biochemistry of Behavior Griffith Lab PowerPoint PPT Presentation
Biochemistry of Behavior Griffith Lab - MAG. Sensory Inputs. Motor Outputs. training. memory. Requires CaMKII for: Cellular Mechanisms ... Chronic Modulation of CaMKII Activity Occludes Plasticity of ...
MAG. Sensory Inputs. Motor Outputs. training. memory. Requires CaMKII for: Cellular Mechanisms ... Chronic Modulation of CaMKII Activity Occludes Plasticity of ...
| PowerPoint PPT presentation | free to view
Figure 8'1 The formation of a memory trace PowerPoint PPT Presentation
Figure 8'1 The formation of a memory trace - Figure 8.2 Components of the classic Morris experiment (Part 1) ... Figure 8.14 Fear conditioning phosphorylates CaMKII in the amygdala ...
Figure 8.2 Components of the classic Morris experiment (Part 1) ... Figure 8.14 Fear conditioning phosphorylates CaMKII in the amygdala ...
| PowerPoint PPT presentation | free to view
Autophosphorylation at Thr286 of the a CalciumCalmodulin Kinase II in LTP and Learning Karl Peter Gi PowerPoint PPT Presentation
Autophosphorylation at Thr286 of the a CalciumCalmodulin Kinase II in LTP and Learning Karl Peter Gi - Total CaMKII (CaM independent dependent) activity remained approximately equal. ... Hidden Platform Version. Performed after Visible Platform Version to verify data ...
Total CaMKII (CaM independent dependent) activity remained approximately equal. ... Hidden Platform Version. Performed after Visible Platform Version to verify data ...
| PowerPoint PPT presentation | free to view
BIPN148 Lecture 11 PowerPoint PPT Presentation
BIPN148 Lecture 11 - (persistently active) CaMKII. CaMKII. Ca / CaM. LTP-induced changes in AMPA currents ... Trafficking of GluR1/2/3. LTP phosphorylation of AMPA-R. GluR1 ...
(persistently active) CaMKII. CaMKII. Ca / CaM. LTP-induced changes in AMPA currents ... Trafficking of GluR1/2/3. LTP phosphorylation of AMPA-R. GluR1 ...
| PowerPoint PPT presentation | free to download
Protein structure and alignment PowerPoint PPT Presentation
Protein structure and alignment - These blocks can vary from rather small segments to rather long domains ... insect, nematode, chordate CaMKII. unc-43 -MQLQQINSGAFSVVRRCVHKTTGLEFAAKIINTKKLSARD ...
These blocks can vary from rather small segments to rather long domains ... insect, nematode, chordate CaMKII. unc-43 -MQLQQINSGAFSVVRRCVHKTTGLEFAAKIINTKKLSARD ...
| PowerPoint PPT presentation | free to view
Molecular mechanisms of long-term memory PowerPoint PPT Presentation
Molecular mechanisms of long-term memory - Title: PowerPoint Presentation Last modified by: Wang Lab Document presentation format: Custom Company: Brandeis University Other titles: Times New Roman Nimbus Roman ...
Title: PowerPoint Presentation Last modified by: Wang Lab Document presentation format: Custom Company: Brandeis University Other titles: Times New Roman Nimbus Roman ...
| PowerPoint PPT presentation | free to download
Chronic psychosocial stress enhances long-term depression in a subthreshold amyloid-beta rat model of Alzheimer's disease PowerPoint PPT Presentation
Chronic psychosocial stress enhances long-term depression in a subthreshold amyloid-beta rat model of Alzheimer's disease - Chronic psychosocial stress enhances long-term depression in a subthreshold amyloid-beta rat model of Alzheimer's disease Tran, Trinh, Srivareerat,et al.
Chronic psychosocial stress enhances long-term depression in a subthreshold amyloid-beta rat model of Alzheimer's disease Tran, Trinh, Srivareerat,et al.
| PowerPoint PPT presentation | free to view
Calcium-dependent gating of Voltage-gated Ca2 channels PowerPoint PPT Presentation
Calcium-dependent gating of Voltage-gated Ca2 channels - Calcium-dependent gating of Voltage-gated Ca2+ channels Regulation by Calmodulin
Calcium-dependent gating of Voltage-gated Ca2+ channels Regulation by Calmodulin
| PowerPoint PPT presentation | free to download
??????????????F1-ATPase????? ?????????? PowerPoint PPT Presentation
??????????????F1-ATPase????? ?????????? - Title: F1 ATPase Author: Karel Svoboda
Title: F1 ATPase Author: Karel Svoboda
| PowerPoint PPT presentation | free to download
Aspetti generali PowerPoint PPT Presentation
Aspetti generali - Title: PowerPoint Presentation Author: A satisfied Microsoft Office User Last modified by: Mauro Created Date: 8/15/2001 11:03:24 AM Document presentation format
Title: PowerPoint Presentation Author: A satisfied Microsoft Office User Last modified by: Mauro Created Date: 8/15/2001 11:03:24 AM Document presentation format
| PowerPoint PPT presentation | free to download
Presentaci PowerPoint PPT Presentation
Presentaci - UN MODELO NEURONAL Y MOLECULAR DE LA MEMORIA: LA POTENCIACI N A LARGO PLAZO (PLP) Inmaculada Cubero Talavera Departamento de Neurociencia y Ciencias de la Salud
UN MODELO NEURONAL Y MOLECULAR DE LA MEMORIA: LA POTENCIACI N A LARGO PLAZO (PLP) Inmaculada Cubero Talavera Departamento de Neurociencia y Ciencias de la Salud
| PowerPoint PPT presentation | free to download
Igor Dzhura is a Dedicated Medical Researcher Based in MA PowerPoint PPT Presentation
Igor Dzhura is a Dedicated Medical Researcher Based in MA - Igor Dzhura has years of experience in the diverse areas of medical research. These include microbiology, biochemistry, cancer research, ion channels regulation and drug discovery. He has worked for a wide range of medical centers and institutes, and accomplished a variety of medical research projects.
Igor Dzhura has years of experience in the diverse areas of medical research. These include microbiology, biochemistry, cancer research, ion channels regulation and drug discovery. He has worked for a wide range of medical centers and institutes, and accomplished a variety of medical research projects.
| PowerPoint PPT presentation | free to download
Proteomics technologies and protein-protein interaction PowerPoint PPT Presentation
Proteomics technologies and protein-protein interaction - Title: PowerPoint Presentation Author: Anders Fausb ll Last modified by: Srinivas Created Date: 1/1/1601 12:00:00 AM Document presentation format
Title: PowerPoint Presentation Author: Anders Fausb ll Last modified by: Srinivas Created Date: 1/1/1601 12:00:00 AM Document presentation format
| PowerPoint PPT presentation | free to view
Learning and Memory: Behaviour and simple PowerPoint PPT Presentation
Learning and Memory: Behaviour and simple - Memory allows the production of a learned/adaptive behaviour at a later time Short-term Memory: ... The basic principle of operant conditioning is that a response ...
Memory allows the production of a learned/adaptive behaviour at a later time Short-term Memory: ... The basic principle of operant conditioning is that a response ...
| PowerPoint PPT presentation | free to view
The boomerang approach to science: Research across the world and back PowerPoint PPT Presentation
The boomerang approach to science: Research across the world and back - Eva R. Chin. Pfizer Global Research & Development. The boomerang approach to ... Dr. Howie Green. Plasma. membrane. SR. Ca2 DHPR. RYR. Force production. Ca2 ...
Eva R. Chin. Pfizer Global Research & Development. The boomerang approach to ... Dr. Howie Green. Plasma. membrane. SR. Ca2 DHPR. RYR. Force production. Ca2 ...
| PowerPoint PPT presentation | free to view
Ras e Rap sono coinvolti nel controllo del traffico dei recettori AMPA durante certe forme di plastiicit PowerPoint PPT Presentation
Ras e Rap sono coinvolti nel controllo del traffico dei recettori AMPA durante certe forme di plastiicit - Ras e Rap sono coinvolti nel controllo del traffico dei recettori AMPA durante certe forme di plastiicit sinaptica La famiglia Ras Un esempio di piccole proteine G ...
Ras e Rap sono coinvolti nel controllo del traffico dei recettori AMPA durante certe forme di plastiicit sinaptica La famiglia Ras Un esempio di piccole proteine G ...
| PowerPoint PPT presentation | free to download
Igor dzhura works in the department of immunology at repro source, inc. PowerPoint PPT Presentation
Igor dzhura works in the department of immunology at repro source, inc. - Igor Dzhura, a Master of Science in Biophysics, holds over 10 years of experience as medical researcher. At present, he is employed at ReproSource Inc., Woburn, MA. Igor Dzhura has worked for Vanderbilt University Medical Center for 8 years and the Bogomoletz Institute of Physiology for 2 years.
Igor Dzhura, a Master of Science in Biophysics, holds over 10 years of experience as medical researcher. At present, he is employed at ReproSource Inc., Woburn, MA. Igor Dzhura has worked for Vanderbilt University Medical Center for 8 years and the Bogomoletz Institute of Physiology for 2 years.
| PowerPoint PPT presentation | free to download
Neuroprotective Effects of Memantine PowerPoint PPT Presentation
Neuroprotective Effects of Memantine - Memantine's effect on -amyloid-induced lesion of the hippocampus ... -amyloid induced neuronal damage. LPS induced inflammation. in vitro on ...
Memantine's effect on -amyloid-induced lesion of the hippocampus ... -amyloid induced neuronal damage. LPS induced inflammation. in vitro on ...
| PowerPoint PPT presentation | free to view
SIGNAL TRANSMISSION WITHIN THE CELL PowerPoint PPT Presentation
SIGNAL TRANSMISSION WITHIN THE CELL - SIGNAL TRANSMISSION WITHIN THE CELL Nela Pavl kov nela.pavlikova@lf3.cuni.cz G-PROTEIN COUPLED RECEPTOR - 7 transmembrane segments G-protein heterotrimer, composed ...
SIGNAL TRANSMISSION WITHIN THE CELL Nela Pavl kov nela.pavlikova@lf3.cuni.cz G-PROTEIN COUPLED RECEPTOR - 7 transmembrane segments G-protein heterotrimer, composed ...
| PowerPoint PPT presentation | free to view
PRENOS SIGN PowerPoint PPT Presentation
PRENOS SIGN - ... Rho spojuje RTK s cytoskeletem ( tvar bu ky, ... Akt RECEPTORY ASOCIOVAN S TYROSINKIN ZOU JAK-STAT RECEPTOROV SERIN-THREONIN KIN ZY ligand: nap .
... Rho spojuje RTK s cytoskeletem ( tvar bu ky, ... Akt RECEPTORY ASOCIOVAN S TYROSINKIN ZOU JAK-STAT RECEPTOROV SERIN-THREONIN KIN ZY ligand: nap .
| PowerPoint PPT presentation | free to view
Dr. R.A.SIDDIQUE PowerPoint PPT Presentation
Dr. R.A.SIDDIQUE - THE ASK1-MAP KINASE CASCADES IN MAMMALIAN STRESS RESPONSE Dr. R.A.SIDDIQUE M.V.Sc., PhD Scholar National Dairy Research Institute, Karnal, Haryana, 132001
THE ASK1-MAP KINASE CASCADES IN MAMMALIAN STRESS RESPONSE Dr. R.A.SIDDIQUE M.V.Sc., PhD Scholar National Dairy Research Institute, Karnal, Haryana, 132001
| PowerPoint PPT presentation | free to download
Human M. tuberculosis infection/ disease: classical pathology and immunology (Slide -1) PowerPoint PPT Presentation
Human M. tuberculosis infection/ disease: classical pathology and immunology (Slide -1) - Human M. tuberculosis infection/ disease: classical pathology and immunology (Slide -1) W. Henry Boom, M.D. Tuberculosis Research Unit (TBRU) Case Western Reserve ...
Human M. tuberculosis infection/ disease: classical pathology and immunology (Slide -1) W. Henry Boom, M.D. Tuberculosis Research Unit (TBRU) Case Western Reserve ...
| PowerPoint PPT presentation | free to view
Mecanismos de sealizacin sinpsis ncleo PowerPoint PPT Presentation
Mecanismos de sealizacin sinpsis ncleo - Mecanismos de sealizacin sinpsis ncleo
Mecanismos de sealizacin sinpsis ncleo
| PowerPoint PPT presentation | free to view
Presentacin del CV PowerPoint PPT Presentation
Presentacin del CV - 4. EL PSIC LOGO Y LA PLASTICIDAD NEURAL: PERPECTIVAS DE FUTURO ... EL PSIC LOGO Y LA PLASTICIDAD NEURAL: CONCLUSIONES Y PERSPECTIVAS DE FUTURO ...
4. EL PSIC LOGO Y LA PLASTICIDAD NEURAL: PERPECTIVAS DE FUTURO ... EL PSIC LOGO Y LA PLASTICIDAD NEURAL: CONCLUSIONES Y PERSPECTIVAS DE FUTURO ...
| PowerPoint PPT presentation | free to view
This is Where You Type the Slide Title PowerPoint PPT Presentation
This is Where You Type the Slide Title - Fear conditioning e.g., Electric shock associated with specific stimuli SCR: Skin Conductance Response (sweat) Fear-relevant: e.g., snake Fear-irrelevant: e.g ...
Fear conditioning e.g., Electric shock associated with specific stimuli SCR: Skin Conductance Response (sweat) Fear-relevant: e.g., snake Fear-irrelevant: e.g ...
| PowerPoint PPT presentation | free to view
Consciousness and the Singularity PowerPoint PPT Presentation
Consciousness and the Singularity - Consciousness and the Singularity
Consciousness and the Singularity
| PowerPoint PPT presentation | free to view
Aspecto molecular en la Enfermedad del Parkinson. PowerPoint PPT Presentation
Aspecto molecular en la Enfermedad del Parkinson. - ... OHDA en ratas produce EP, y la terapia con DA cr nica dada intermitentemente produce en pocas semanas alteraciones motoras tipo on off fluctuaciones.
... OHDA en ratas produce EP, y la terapia con DA cr nica dada intermitentemente produce en pocas semanas alteraciones motoras tipo on off fluctuaciones.
| PowerPoint PPT presentation | free to download
Kim PowerPoint PPT Presentation
Kim - ... P type found in cerebellar Purkinje cells ... for each transport cycle Small current ... matches dendritic calcium decay Solely ...
... P type found in cerebellar Purkinje cells ... for each transport cycle Small current ... matches dendritic calcium decay Solely ...
| PowerPoint PPT presentation | free to download
Spatial Stochastic Simulators PowerPoint PPT Presentation
Spatial Stochastic Simulators - ... remove the short term plasticity ... STDP example Calmodulin activation versus spike timing Do NMDA ... Neuron model to determine voltage-dependent open ...
... remove the short term plasticity ... STDP example Calmodulin activation versus spike timing Do NMDA ... Neuron model to determine voltage-dependent open ...
| PowerPoint PPT presentation | free to download
Pathways between Genes and Behaviour PowerPoint PPT Presentation
Pathways between Genes and Behaviour - Pathways between Genes and Behaviour
Pathways between Genes and Behaviour
| PowerPoint PPT presentation | free to download
GPCRs and their effectors: signal transduction pathways and the cardiovascular system BIOM 200AB Nov PowerPoint PPT Presentation
GPCRs and their effectors: signal transduction pathways and the cardiovascular system BIOM 200AB Nov - GPCRs and their effectors: signal transduction pathways and the cardiovascular system BIOM 200AB Nov
GPCRs and their effectors: signal transduction pathways and the cardiovascular system BIOM 200AB Nov
| PowerPoint PPT presentation | free to view
Glutamate PowerPoint PPT Presentation
Glutamate - Glutamate & GABA Glutamate Glutamate (and aspartate) are two of the major excitatory amino acids Glutamate is ionized form of the amnio acid glutamic acid, which is ...
Glutamate & GABA Glutamate Glutamate (and aspartate) are two of the major excitatory amino acids Glutamate is ionized form of the amnio acid glutamic acid, which is ...
| PowerPoint PPT presentation | free to view
Molecular mechanisms of memory PowerPoint PPT Presentation
Molecular mechanisms of memory - How does the brain achieve Hebbian plasticity? ... Recall that glutamate is the main excitatory neurotransmitter in the brain. ...
How does the brain achieve Hebbian plasticity? ... Recall that glutamate is the main excitatory neurotransmitter in the brain. ...
| PowerPoint PPT presentation | free to view
Diffusion of CaM and CaMK-II PowerPoint PPT Presentation
Diffusion of CaM and CaMK-II - Fluorescent intensity is recorded as a function of time. ... G(0) is inversely proportional to the concentration. ... The time is called. ...
Fluorescent intensity is recorded as a function of time. ... G(0) is inversely proportional to the concentration. ... The time is called. ...
| PowerPoint PPT presentation | free to download
Maintenance and Synaptic stability PowerPoint PPT Presentation
Maintenance and Synaptic stability - ... can be expressed by protein number or state. ... solution, a molecular switch (Crick, ... how can it effect different synapses differently in order to ...
... can be expressed by protein number or state. ... solution, a molecular switch (Crick, ... how can it effect different synapses differently in order to ...
| PowerPoint PPT presentation | free to view
Why do we care about a sequence alignment PowerPoint PPT Presentation
Why do we care about a sequence alignment - Simple and Affine Gap Scores ... Affine gap penalties have an open penalty and a ... a multi-tiered affine gap score is required to fit existing data sets well. ...
Simple and Affine Gap Scores ... Affine gap penalties have an open penalty and a ... a multi-tiered affine gap score is required to fit existing data sets well. ...
| PowerPoint PPT presentation | free to view
Developing New Assays for FXM PowerPoint PPT Presentation
Developing New Assays for FXM - Gain insight on Ca2 responses to different ligands ... Number of assays needed will not increase proportionally as we expand beyond FXM ...
Gain insight on Ca2 responses to different ligands ... Number of assays needed will not increase proportionally as we expand beyond FXM ...
| PowerPoint PPT presentation | free to download
Plasticit PowerPoint PPT Presentation
Plasticit - tant donn que les modifications anatomiques se produisaient dans les cellules ... de synchronisation entre le ph nom ne lectrique et les observations anatomiques. ...
tant donn que les modifications anatomiques se produisaient dans les cellules ... de synchronisation entre le ph nom ne lectrique et les observations anatomiques. ...
| PowerPoint PPT presentation | free to download
KO mice PowerPoint PPT Presentation
KO mice - a new gene is added that is not normally present in the mouse genome modell of diseases ... mice are nocturnal spieces, home cage activity is higher during the ...
a new gene is added that is not normally present in the mouse genome modell of diseases ... mice are nocturnal spieces, home cage activity is higher during the ...
| PowerPoint PPT presentation | free to view
Molecular Mechanisms of Learning and Memory PowerPoint PPT Presentation
Molecular Mechanisms of Learning and Memory - The sea slug Aplysis californica, is used for studies in neurobiology ... squirted on a portion of the slug (the siphon) causes withdrawal of the siphon & the gill ...
The sea slug Aplysis californica, is used for studies in neurobiology ... squirted on a portion of the slug (the siphon) causes withdrawal of the siphon & the gill ...
| PowerPoint PPT presentation | free to view
Neurogenetics PowerPoint PPT Presentation
Neurogenetics - Negative feedback for transcription inside the nucleus. ... Anesthesia resistant (ARM) Long term (LTM) Induced mutations. Learning and memory ...
Negative feedback for transcription inside the nucleus. ... Anesthesia resistant (ARM) Long term (LTM) Induced mutations. Learning and memory ...
| PowerPoint PPT presentation | free to view
Bootstrap and jackknife calculation resampling PowerPoint PPT Presentation
Bootstrap and jackknife calculation resampling - Bootstrap and jack-knife calculation (resampling) General principal is to stress ... Jack-knife: drop each of N sequences from the alignment and recompute the ...
Bootstrap and jack-knife calculation (resampling) General principal is to stress ... Jack-knife: drop each of N sequences from the alignment and recompute the ...
| PowerPoint PPT presentation | free to view
Wednesday May 3 PowerPoint PPT Presentation
Wednesday May 3 - ... fire more easily and unblock Mg , then NMDAs cause postsynaptic ... Circuits from hippocampus to cortical sites are relevant for retrieval of newer LTMs ...
... fire more easily and unblock Mg , then NMDAs cause postsynaptic ... Circuits from hippocampus to cortical sites are relevant for retrieval of newer LTMs ...
| PowerPoint PPT presentation | free to view
LINKS BETWEEN LTP AND LEARNING AND MEMORY Does LTP = learning? Physiological -- cognitive PowerPoint PPT Presentation
LINKS BETWEEN LTP AND LEARNING AND MEMORY Does LTP = learning? Physiological -- cognitive - LINKS BETWEEN LTP AND LEARNING AND MEMORY Does LTP = learning? Physiological -- cognitive Evidence 1. Molecular approaches relating LTP to learning
LINKS BETWEEN LTP AND LEARNING AND MEMORY Does LTP = learning? Physiological -- cognitive Evidence 1. Molecular approaches relating LTP to learning
| PowerPoint PPT presentation | free to view
Learning and Memory PowerPoint PPT Presentation
Learning and Memory - Title: Biological Psychology, 6e Last modified by: Jason Dirks Created Date: 10/16/2000 7:08:56 PM Document presentation format: On-screen Show Company
Title: Biological Psychology, 6e Last modified by: Jason Dirks Created Date: 10/16/2000 7:08:56 PM Document presentation format: On-screen Show Company
| PowerPoint PPT presentation | free to download
LINKS BETWEEN LTP AND LEARNING AND MEMORY Does LTP = learning? Physiological -- cognitive PowerPoint PPT Presentation
LINKS BETWEEN LTP AND LEARNING AND MEMORY Does LTP = learning? Physiological -- cognitive - ... dentate gyrus LTP ... (subiculum - granule cells in dentate gyrus) Mossy fiber pathway ... field EPSP (at the site of perforant-path dentate gyrus) ...
... dentate gyrus LTP ... (subiculum - granule cells in dentate gyrus) Mossy fiber pathway ... field EPSP (at the site of perforant-path dentate gyrus) ...
| PowerPoint PPT presentation | free to view
ANXIETY, DEPRESSION AND NEURODEGENERATIVE DISEASES: NOVEL RESULTS IN THE DISCOVERY OF THEIR PATHOMEC PowerPoint PPT Presentation
ANXIETY, DEPRESSION AND NEURODEGENERATIVE DISEASES: NOVEL RESULTS IN THE DISCOVERY OF THEIR PATHOMEC - Biological Research Center of Szeged of the Hungarian ... Amyloid surface binding molecules - Competitive inhibitors (RGD peptides?) - Memantine /NMDA ...
Biological Research Center of Szeged of the Hungarian ... Amyloid surface binding molecules - Competitive inhibitors (RGD peptides?) - Memantine /NMDA ...
| PowerPoint PPT presentation | free to view
Learning the cis regulatory code by predictive modeling of gene regulation (MEDUSA) PowerPoint PPT Presentation
Learning the cis regulatory code by predictive modeling of gene regulation (MEDUSA) - Learning the cis regulatory code by predictive modeling of gene regulation MEDUSA
Learning the cis regulatory code by predictive modeling of gene regulation MEDUSA
| PowerPoint PPT presentation | free to download
Depression PowerPoint PPT Presentation
Depression - A lot of maternal care in rats upregulates glucocorticoid receptors in hippocampus There is evidence that neurogenesis in the hippocampus is important for mood ...
A lot of maternal care in rats upregulates glucocorticoid receptors in hippocampus There is evidence that neurogenesis in the hippocampus is important for mood ...
| PowerPoint PPT presentation | free to view
Marina Picciotto PowerPoint PPT Presentation
Marina Picciotto - Marina Picciotto
Marina Picciotto
| PowerPoint PPT presentation | free to view
BioMEMS for Instrumenting and Controlling the Single Cell PowerPoint PPT Presentation
BioMEMS for Instrumenting and Controlling the Single Cell - BioMEMS for Instrumenting and Controlling the Single Cell
BioMEMS for Instrumenting and Controlling the Single Cell
| PowerPoint PPT presentation | free to download


Home About Us Terms and Conditions Privacy Policy Contact Us
Copyright 2025 CrystalGraphics, Inc. — All rights Reserved. PowerShow.com is a trademark of CrystalGraphics, Inc.
camkii — Search results on PowerShow.com