Title: Cytochrom P450, Polymorphism, Transporters
1Cytochrom P450, Polymorphism, Transporters
2Absorption and Metabolism
Nutricients as wells as xenobiotics enter the
blood circulation via the portal vein from the
small intestine and reach the liver. Here, a
variety of biochemical conversions of all
substances is carried out.
3Cytochrome P450 Metabolism (I)
First reactions First pass effect predominately
lipophilic or heavy (MW gt500) compounds are
metabolized eccessively, whereby they become more
hydrophilic and thus easier to excret.
For the reactions comprising Phase I mainly the
group of cytochrome P450 enzymes (CYP) is
responsible.Usually substances are oxidized
(formal addition of oxygen redox reaction)
4Cytochrome P450 Metabolisms (II)
This mono-oxygenation of the substrates occurs in
a catalytic cycle mediated by a hemoglobin-iron
(Fe)
5Cytochrome P450 Metabolismus (III)
The cytochrome enzymes that account for the
metabolism are predominately mono-oxygenases that
evolved from enzymes for steroid and fatty acid
synthesis.
In human 17 CYP-families containing about 50
isoforms have been characterized so far
classification CYP 3 A 4
15 A-B
familygt40 sequence-homology
isoenzyme
allele
subfamilygt55 sequence-homology
6Cytochrome P450 Gene families
Human 14
Molluscs 1
CYP450
Plants 22
Insects 3
Bacteria 18
Yeasts 2
Nematodes 3
Fungi 11
7Human cytochrome P450 family
From the super-familiy of the cytochromes, the
following families have been found in human CYP
1-5, 7, 8, 11, 17, 19, 21, 24, 26, 27, 39, 46, 51
CYP 1, 2A, 2B, 2C, 2D, 2E, 3 metabolisms of
xenobiotics CYP 2G1, 7, 8B1, 11, 17, 19,
21, 27A1, 46, 51 steroid
metabolisms CYP 2J2, 4, 5, 8A1 fatty acids
metabolisms CYP 24 (vitamine D), 26 (retinoic
acid), 27B1 (vitamine D), ...
8Cytochrome P450 Enzymes (I)
flavin monooxygenase isoenzyme alcohol
dehydrogenase aldehyde oxidase monoamine
dehydrogenase (MAO)
The redox activity is mediated by an iron
porphyrin in the active site
9Cytochrome P450 Enzymes (II)
Despite the low sequence identity of CYPs from
different species, the tertiary structure
ishighly conserved, esp. in theactive center.
In the loopregions, however, strongdeviations
occur.
Superposition of humanhCYP 2C9 (1OG5.pdb)
andCYP 450 BM3 (2BMH.pdb) Bacillus megaterium
In contrast to bacterial CYPs, the microsomal
mammalian CYPs possess an additional
transmembrane helix that serves as an anchor in
the membrane.
10Cytochrome P450 Enzymes (III)
The prevailing amount of CYPs is present in the
liver, however, certain CYPs are also found in
cells of the instestine wall.
the mammalian CYPs are bound to the endoplasmatic
reticulum and thus membrane bound.
11Cytochrome P450 Enzymes (IV)
The metabolism of endogenous substances
(xenobiotics) is carried out predominately by CYP
3A4, CYP 2D6, andCYP 2C9.
involved in the metabolismof gt20 of all drugs
12Substrate specificity of CYPs (I)
Specific substrates of certain human CYPs CYP
1A2 verapamil, imipramine, amitryptiline, caffei
ne (arylamine N-oxidation)
CYP 2A6 nicotine
CYP 2B6 cyclophosphamid
CYP 2C9 diclofenac, naproxen, piroxicam, warfarin
CYP 2C19 diazepam, omeprazole, propanolol
CYP 2D6 amitryptiline, captopril, codeine,
mianserin, chlorpromazine
CYP 2E1 dapsone, ethanol, halothane, paracetamol
CYP 3A4 alprazolam, cisapride, terfenadine, ...
see http//medicine.iupui.edu/flockhart/
13Substrate specificity of CYPs (II)
Decision tree for human P450 substrates
CYP 1A2, CYP 2A-E, CYP 3A4
high
low
CYP 3A4
CYP 2E1
Volume
medium
acidic
basic
pKa
CYP 2D6
CYP 2C9
neutral
CYP 1A2, CYP 2A, 2B
low
high
planarity
CYP 2B6
CYP 1A2
medium
CYP 2A6
Lit D.F.V. Lewis Biochem. Pharmacol. 60 (2000)
293
14Prediction Models for Cytochrome P450 Metabolism
(I)
Decision Tree for substrate specificity ?
Identification of relevant descriptors
Lit. L.Terfloth et al. J.Chem.Inf.Model. 47
(2007) 1688-1701.
Major source of experimental dataS.Rendic Drug
Metabol.Rev. 34 (2002) 83-448.
15Prediction Models for Cytochrome P450 Metabolism
(II)
Qualitative prediction of metabolism for specific
CYPs Binary classification into substrates /
non-substrates inhibitors /
non-inhibitors Problems partial overlap of
inhibitors and non-substrates variability of data
sets (how much of a non-substrate is
metabolized?) Used machine learning algorithms
decision trees, neural networks, support vector
machines, k-nearest neighbor
Lit. C.W.Yap Y.Z.Chen J.Chem.Inf.Model. 45
(2005) 982-992. J.M.Kriegl et al. QSAR
Comb.Sci. 24 (2005) 491-502. P.S.Bazeley et
al. J.Chem.Inf.Model. 46 (2006) 2698-2708.
B.F.Jensen et al. J.Med.Chem. 50 (2007) 501-511.
16Cytochrome P450 Metabolism (IV)
During pre-clinical development it is of
importance to characterize also the metabolic
products of drugs since these might be toxic
themselves. Experimentally, the according (human)
CYP-enzymes are expressed in E. coli, and the
conversion is monitored by gas chromatography and
mass spectroscopy. This allows the selective
determination of metabolites by single cytochrome
P450 enzymes and their genetic variants. The
results are used to compared with corresponding
in vivo results from animals in order to chose
the appropriate animal model (mouse, dog, guinea
pig,...).
Lit. Regarding cloningR.Knippers, Molekulare
Genetik 8.Auflage, Kapitel 10
17Cytochrome P450 polymorphism
Every human differs (more or less)
The phenotype can be distinguished by the actual
activity or the amount of the expressed CYP
enzyme.
The genotype, however, is determined by the
individualDNA sequence. Human two sets of
chromosomes (diploid)
That mean The same genotype enables different
phenotypes
Depending on the metabolic activity, three major
cathegories of metabolizers are separated
extensive metabolizer (normal), poor metabolizer,
and ultra-rapid metabolizer (increased metabolism
of xenobiotics)
Lit K. Nagata et al. Drug Metabol. Pharmacokin
3 (2002) 167
18Single Nucleotide Polymorphism (SNP)
SNPs are differences of single bases in the DNA
that can be observed between individuals in a
population. Alleles occuring in at least 1 of
the population are defined as polymorphism. E.g.
these genotypes are ordinary. Conversely,
differences in the genom that occur in less than
1 are refered to as mutations.
In the case of rare inhereted diseases, typically
mutations in the coding region of DNA sequences
are observed.
Lit A.D. Rose Nature 405 (2000) 857.
19CYP 2D6 Polymorphism (I)
The polymorphismus of CYP 2D6 (debrisoquine
4-hydroxylase) has been studied in great detail,
as metabolic differences have first been
described for debrisoquine and sparteine
(antipsychotics)
See D.B.Goldstein et al. Nature Rev. Genetics 4
(2003) 937.
localized on chromosome 22Of the 75 allels, 26
exprime CYP2D6 proteinessee http//www.imm.ki.se/
CYPalleles/cyp2d6.htm
20CYP 2D6 Polymorphisms (II)
Lit J. van der Weide et al. Ann. Clin. Biochem
36 (1999) 722
21CYP 2D6 Polymorphismus (III)
MGLEALVPLAVIVAIFLLLVDLMHRRQRWAARYPPGPLPLPGLGNLLHVD
FQNTPYCFDQ LRRRFGDVFSLQLAWTPVVVLNGLAAVREALVTHGEDT
ADRPPVPITQILGFGPRSQGVF LARYGPAWREQRRFSVSTLRNLGLGK
KSLEQWVTEEAACLCAAFANHSGRPFRPNGLLDK AVSNVIASLTCGRR
FEYDDPRFLRLLDLAQEGLKEESGFLREVLNAVPVLLHIPALAGKV LRF
QKAFLTQLDELLTEHRMTWDPAQPPRDLTEAFLAEMEKAKGNPESSFNDE
NLRIVVA DLFSAGMVTTSTTLAWGLLLMILHPDVQRRVQQEIDDVIGQ
VRRPEMGDQAHMPYTTAVI HEVQRFGDIVPLGMTHMTSRDIEVQGFRI
PKGTTLITNLSSVLKDEAVWEKPFRFHPEHF LDAQGHFVKPEAFLPFSA
GRRACLGEPLARMELFLFFTSLLQHFSFSVPTGQPRPSHHGV FAFLVSP
SPYELCAVPR
poor debrisoquine metabolism S
R impaired mechanism of sparteine
poor debrisoquine metabolism I
poor debrisoquine metabolism R
missing in CYP2D69 allele
P loss of activity in CYP2D67
T impaired metabolism of sparteine in alleles 2,
10, 12, 14 and 17 of CYP2D6
see http//www.expasy.org/cgi-bin/niceprot.pl?P106
35
22CYP 2D6 Polymorphism (IV)
variability of debrisoquine-4-hydroxylation
number of individuals (european population)
homocygote extensive metabolizers
homocygote poor metabolizers
metabolic rate
heterocygote extensive metabolizers
Lit T. Winkler Deutsche Apothekerzeitung 140
(2000) 38
23CYP 2D6 Polymorphismus (V)
the poor metabolizer phenotyp has consequences
for the metabolism of more than 25 of all common
drugs, since it causes an increased concentration
of xenobiotics that are not metabolized.
Lit H.K.Kroemer M.Eichelbaum. Life Sci. 56
(1995) 2285.
Thus, CYP2D6 genotyping is already applied to
select appropriate test candiates in phase II of
clinical tests lamotrigine, desipramine
(Antidepressiva)
Lit M.P.Murphy et al. Pharmacogenetics 10 (2000)
583.
24Polymorphism of further CYPs
CYP 1A2 individual strong, medium, and slow
conversion of caffeine CYP 2B6 absent in 3-4 of
the caucasian population CYP 2C9 deficit in 1-3
of the caucasian population CYP 2C19 individues
with inactiv enzyme (3-6 of the caucasian and
15-20 of the asian population) CYP 2D6 poor
metabolizers in 5-8 of the european,10 of
the caucasian and lt1 in the japanese population.
Overexpression (gene duplication) in parts of the
african and oriental population CYP 3A4 only few
mutations known in connection with the
polymorphism of the MDR1 transporter gene
25Genotyping for P450 alleles
Affymetrix (US) has developped microarrays (gene
chips) using immobilized synthetic copies of P450
nucleotides, that allow the identification of all
clinically relevant allelic variants.
26Induction and regulation of CYP3A (I)
A series of xenobiotics have been identified that
lead to increased expression of enzymes of the
CYP3A family.indinavir antiviralefavirenz
antiviralcyclosporine immuno-suppressantcarba
mazepine antipsychoticatorvastatin HMG CoA
reductase inhibitor tamoxifen anti-hormone
These bind to the pregnane X receptor (PXR) which
is the transcription factor for the regulation of
the CYP3A gene expression.
Lit T.M. Wilson et al. Nature Rev. Drug Disc. 1
(2002) 259
27Induction and regulation of CYP3A (II)
The PXR receptor operates together with the
retinoid X receptor (RXR) as a heterodimer.
CYP3A induction leads to an increased metabolism
of the administered substance due to upregulated
enzymes.This can cause adverse reactions, like
inflammation of the liver (hepatitis).
Lit T.M. Wilson et al. Nature Rev. Drug Disc. 1
(2002) 259
28RXR and other nuclear receptors (I)
As a specific, endogen activator of RXR,
5b-pregnane-3,20-dione has been identified. In
contrast, PXR is much less specific and is
activated by glucocorticoids as well as by
anti-glucocorticoids.
Conversely, the unspecific constitutive androgen
receptor (CAR) is found in the cytoplasm and
dimerizes with PXR in the nucleus. Analog to PXR,
the CYP2B gene is regulated.
Likewise high sequence homology has been found
for the vitamine D receptor (VDR) that regulates
CYP27, and for the arylhydrocarbon receptor (AHR)
(dioxin receptor).
29RXR and other nuclear receptors (II)
These nuclear receptors all belong to a family of
transcription factors. Each one possess a double
zinc-finger DNA-binding domain (DBD), and a
larger ligand binding domain (LBD) which is
located at the carboxy terminal.
They have been called orphan nuclear receptors as
their ligands have been found later.
30Zinc finger motiv
The zinc ion is coordinated by two cysteines and
two histidines.
The protein Zif268 contains threezinc fingers
motives in complex with the DNA
Source Wikipedia
31Human Orphan Nuclear Receptors
receptor (gene ID) natural ligand (synthetic
ligand) CAR (NR1I3) 3a,5a-androstanolCOUP
(NR2F1) ERR (NR3B1) (4-hydroxytamoxifen)FXR
(NR1H4) chenodeoxycholic acidHNF4
(NR2A1) palmitic acidLRH (NR5A2) PPAR
(NR1C1) eicosapentaenoic acidPXR
(NR1I2) 5b-pregnane-3,20-dione, (rifampicin)ROR
(NR1F1) stearic acidRXR (NR2B1) 9-cis-RNA
(Selection only, for more see the cited reference)
Lit T.M.Wilson J.T. Moore Mol. Endocrin. 16
(2002) 1135.
32Induction and regulation of CYP3A (III)
hyperforin, a natural ingredient of St. Johns
wort (Johanniskraut, Hypericum performatum)
exhibits the highest measured affinity to PXR (Kd
27 nM) so far.
Application remedy against cholestasis
Gallestauung, mild antidepressant (heavily
debated if available concentration in
preparations of St. Johns wort is sufficiently
high)
33Induction and regulation of CYP3A (IV)
X-ray structure of PXR complexed with hyperforin
(1M13.pdb)
Lit R.E. Watkins et al. Biochemistry 42 (2003)
1430
34Induction of further CYPs
CYP 1A2 omeprazole, insulin, aromatic
hydrocarbons (cigarette smoking, charbroiled
meat)
causes increased caffeine level in the plasma, if
you quit smoking.
CYP 2C9 rifampicin, secobarbital
CYP 2C19 carbamazepine, prednisone
CYP 2D6 dexamethason
CYP 2E1 ethanol, isoniazid
CYP 3A4 glucocorticoides, phenobarbitone,
rifampicin, nevirapine, sulfadimindine,
nevirapine, sulfinpyrazone, troglitazone
35Typical inhibitors of various CYPs
CYP 1A2 cimetidine, ciprofloxacine,
enoxacine... grapefruit juice (naringin,
6,7-dihydroxy- bergamottin)
CYP 2C9 chloramphenicol, amiodarone,
omeprazole,...
CYP 2C19 fluoxetine, fluvastatin, sertraline,...
CYP 2D6 fluoxetine, paroxetine, quinidine,
haloperidol, ritonavir,...
CYP 2E1 disulfiram, cimetidine,...
CYP 3A4 cannabinoids, erythromycin, ritonavir,
ketoconazole, grapefruit juice
see http//medicine.iupui.edu/flockhart/
36Transporters (I)
In contrast to the passive diffusion through
membranes transporters cause increased influx
into, or conversely efflux from compartments,
whereby ATP is consumed.(active transport)
Lit A.Ayrton et al. Xenobiotica 31 (2001) 469
37Transporters (II)
Membrane bound transporters involved in the
pharmacokinetic of endogenous substances
superfamilies solute carriers (SLC) ATP-binding
cassette (ABC) P-type ATPase
Lit M.K.Leabman et al. Proc.Nat.Acad.Sci.USA 100
(2003) 5896
38Structure of membrane-bound transporters
Membrane-bound transporters are proteins with up
to 12 and more transmembrane helices that are
connected by loops. So far no X-ray structure of
a transporter has been achieved.
Lit M.K.Leabman et al. Proc.Nat.Acad.Sci.USA 100
(2003) 5896
39P-glycoprotein
P-gp belongs to the group of multidrug resistant
proteins (MDR) and is encoded by the MDR1
gene.Especially the bioavailability of
antipsychotics is limited by the mediated efflux
from the brain and central nervous system back
into the system blood circulation. Likewise
transport of substances from the liver into the
gastrointestine (bilary excretion) e.g. of
indinavir Overexpression of P-gp in cancer cells
leads to resistance against antineoplastics.
Lit A.Ayrton et al. Xenobiotica 31 (2001)
469.A.Seelig Eur.J.Biochem. 251 (1998) 252.
40Transporter proteins for organic ions
Comprising the families of the Organic Anion
Transporters (OAT) and the Organic Cation
Transporters (OCT) The contribute in particular
to the excretion of hydrophilic metabolites and
katabolites.
Lit A.Ayrton et al. Xenobiotica 31 (2001) 469
41Transporter proteins for influx
There are also transporters that mediate the
active uptake of substance from the intestine
Pept1 (intestinal peptide transporter)
transmembrane protein possesing 12
TM-helicesResponsible for the uptake of nitrogen
! substrates small peptides (di- and
tripeptide, as well as compounds exhibiting
peptide-like features, e.g. captopril)
42Polymorphisms of transporters
Also transporters show considerable genetic
variationsgene protein / function ABCB1
(ATP-binding cassette subfamily B member 1) P-gp
efflux SLC6A3 (dopamine transporter)
neurotransmitter SLC6A4 (serotonin transporter)
neurotransmitter ADRB2 (b-adrenergic receptor)
rezeptor for b-blocker ALOX5 (arachidonate
5-lipoxygenase) biosynthesis of
leukotrienes
See D.B.Goldstein et al. Nature Rev. Genetics 4
(2003) 937.