Title: HIV Sequence Variation, Drug Resistance, and Laboratory Testing
1HIV Sequence Variation, Drug Resistance, and
Laboratory Testing
- Robert Shafer, MD
- Division of Infectious Diseases
- Stanford University
- (10/23/04)
2Outline
- HIV-1 genetic variation and drug resistance
- Molecular targets of therapy and drug resistance
testing - Drug resistance surveillance
- New drugs
- New laboratory markers
332 yo man with drug-resistant HIV infection - 1
- 32 man diagnosed with HIV in 1989
- 1992 AZT 1994 AZT ddC
- Sept 1994 Phase I/II trialSQV 1800 mg TID
- 8 wk CD4 229 gt 472, HIV RNA 180,000 gt
12,000 - 24 wk CD4 and HIV RNA back to baseline
- Sept 1994 to Sept 1996 patient took 3 different
HAART regimens including d4T 3TC IDV then d4T
ddI RTV SQV then AZT ddI 3TC - Each time HIV RNA decreased 1-1.5 logs but never
lt400 and eventually increased to 10,000-20,000.
CD4 stable at about 240
432 yo man with drug-resistant HIV infection - 2
- RT M41L, D67N, L210W, T215Y, K219N M184V
E44D, V118I - Protease G48V, I54T, V82A L10I, L63H, A71V,
V77I - PBMC susceptibility assay
- AZT, 3TC gt100-fold resistant
- ddI, ddC, d4T 3- to 5-fold resistant
- SQV, IDV, RTV, NFV 30- to 100-fold resistant
- NVP susceptible
- Patient asked for advice on drug therapy
532 yo man with drug-resistant HIV infection - 3
- 1/97 Patient D/Cd HAART regimenHIV RNA
increased 10,000 gt 250,000 CD4 stayed the same
at about 240 cells - Patient restarted HAART d4T 3TC RTV SQV
632 yo man with drug-resistant HIV infection - 4
- 1998 to 1999 EFV, ABC, APV, and PMEA became
available - CD4 180-200 HIV RNA 20,000-30,000
732 yo man with drug-resistant HIV infection - 5
- 1998-1999 HIV RNA ? to 300,000 and CD4 ? to 105
- June 1999, patient enrolled in a Phase I/II study
of T20. Eligibility criteria must be NNRTI
naive - Began T20 EFV ABC RTV/APV
- Sept 1999 HIV RNA lt50 CD4 260
- May 2000 HIV RNA lt50 CD4 260
- Jan 2002 HIV RNA lt50 CD4 300
8(No Transcript)
9Drug Resistance in the HAART Era
- Many heavily-treated persons already have highly
drug-resistant viruses - Primary drug resistance is common
- Margin of success is narrow
10HIV Genetic Variation
- Generation of variation
- No RT proofreading 1 error per 104 - 105
nucleotides - High replication rate
- Recombination
- Proviral DNA archive
- Selection of variants
- Chance (neutral substitutions)
- Host immune system
- Anti-HIV drugs
11Two Types of RNA Virus Variability
12HIV Genetic Variation
0.10
Korber et al. 2001
13Primate Immunodeficiency Viruses
- HIV-1 is one of gt 5 primate lentiviruses (PIV)
that share similar genomic structures and
phylogenetic relatedness. - HIV-1 and HIV-2 infect humans.
- Each of the viruses infect old world primates.
Primate infection is generally species-dependent. - HIV-1 and HIV-2 cause disease in humans. HIV-1,
HIV-2, and the other PIV rarely cause disease in
primates.
14Origin of HIV-1
- The HIV-1 pandemic resulted from a single
cross-species transmission that took place
sometime prior to 1959 probably within this
century (Group M). - HIV-1 was probably transmitted to humans from a
Common chimpanzee (Pan troglodytes). - At least 2 other cross-species transmissions have
occurred (Group O, Group N).
15HIV-1 Groups
- Group M (main) viruses are responsible for the
HIV-1 pandemic. They resulted from a single
cross-species transmission sometime this century
and have evolved into 6-10 subtypes. - Group O (outlier) resulted from a separate
cross-species transmission and less widespread. - Group N (non-M, non-O) was identified in 1998 and
represents a third cross-species transmission.
16HIV-1 Subtypes
- HIV-1 Group M has evolved into 9 different pure
subtypes (A, B, C, D, F, G, H, J, K), two common
recombinant forms (A/E, A/G), and countless other
recombinant and mosaic forms. - Subtypes differ from each other by 10-30 in
different parts of the HIV genome. - There are no proven biological differences
between the different subtypes.
17Timing the Ancestor of the HIV Pandemic Strains.
Korber et al. Science 2000
18Evidence of HIV-1 adaptation to HLA-restricted
immune responses at a population level
Moore et al. Science 2002
19Intrahost Evolution
- Evading host immune response
- Developing drug resistance
- Change in co-receptor utilization
- NSI (CCR5) ? SI (CXCR4)
20Leading Causes of Death Among Persons 25-44,
USA, 1982-1998
Preliminary 1998 data
National Center for Health Statistics National
Vital Statistics System
21Targets of Drug Therapy
- Reverse transcriptase
- Nucleoside analogs (8)
- Non-nucleoside inhibitors (3)
- Protease
- Protease inhibitors (7)
- Cell entry
- Fusion inhibitor (1)
- Chemokine receptor inhibitors
22(No Transcript)
23HIV-1 Protease Bound to an Inhibitor
Active site
Substrate Cleft
Indinavir
24HIV-1 Protease Drug Resistance Mutations
Active site
Substrate Cleft
Major mutations
Indinavir
Minor mutations
25 Conserved
Known resistance mutation
Treatment-associated mutation
Polymorphic, not associated with Rx
26HIV-1 RT with RNA Template, DNA primer, and
Catalytic Complex
p66
p51
Active site
Incoming nucleotide
27HIV-1 RT Active Site and Nucleoside Analog Drug
Resistance Mutations
Active site
Drug resistance mutations
Incoming nucleotide
28HIV-1 RT Bound to a Non-Nucleoside RT Inhibitor
(NNRTI)
Active site
Nevirapine
29NNRTI-Associated Drug Resistance Mutations
Active site
Nevirapine
Drug resistance mutations
30Types of HIV Drug Susceptibility Assays
31Advantages of Recombinant Virus Assays
- Can test cryopreserved samples including plasma,
serum - Assesses circulating virus
- Culture unnecessary
- Automated
32Creating a Recombinant Virus
PCR fragment (gag/Pro/RT)
Transfect
WT lab strain
Infectious virus
Deleted proviral clone
T-cell
33Region Covered by Phenotyping
34Drug Susceptibility - Dose Response Curves
100
Antiviral Effect ()
Wild type lab strain
50
Patient strain
0
IC50, WT
IC50, pt
Drug Concentration
IC50 50 inhibitory concentration Fold change
IC50, pt / IC50, WT Example IC50, pt 5 µM and
IC50, WT 0.5 µM ? 10-fold change
35Drug susceptibility cut-offs
- Technical cut-offs are derived from the
reproducibility of the assay on an individual
sample - Biological cut-offs are derived by testing large
numbers of wildtype isolates from untreated
persons - Clinical cut-offs are derived from data
correlating drug susceptibility to a drug and
virologic response to that drug
36Genotype vs Phenotype
37HIV-1 Quasi-Species Distribution of Genetic
Variants
21 clones of HIV-1 protease from the plasma of a
heavily treated patient
38Sequence Mixtures
39Gene Sequencing
- Research Identify new drug-resistance mutations
- Clinical Identify known drug resistance
mutations. - --------------------------------------------------
---------------------------- - Plasma is ultracentrifuged and RNA is extracted
- Extracted RNA is reverse transcribed to cDNA
- Nested PCR generates 1.3 kb amplicon containing
protease and 1st 300 residues of RT - Dideoxynucleoside cycle sequencing
- Reaction products are resolved electrophoretically
40Molecular Targets of HIV Therapy
GAG
POL
ENV
Pr
RT
INT
297 na
1680 na
kb
41Genotypic Resistance Testing - I
CCTCAGATCACTCTTTGGCAACGACCCATAGTCACAATAAAGATAGCGGG
ACAACTAAAGGAAGCTCTATTAGATACAGGAGCAGATGATACAGTATTAG
AAGAAATGAATTTGCCAGGAAAATGGAAACCAAAAATAATAGTGGGAATT
GGAGGGTTTACCAAAGTAAGACAGTATGATCATGTACAAATAGAAATCTG
TGGACATAAAGTTATAGGTGCAGTATTAATAGGACCTACACCTGCCAATA
TAATTGGAAGAAATCTGTTGACTCAGCTTGGCTGTACTTTAAATTTT
PQITLWQRPIVTIKIAGQLKEALLDTGADDTVLEEMNLPGKWKPKIIVGI
GGFTKVRQYDHVQIEICGHKVIGAVLIGPTPANIIGRNLLTQLGCTLNF
Differences from Consensus B L10I, G17R, K20I,
E35D, N37S, M46I, I62V, L63P, A71I, G73S, I84V,
L90M, I93L
42Interlaboratory Reproducibility Sequencing Plasma
from Heavily Treated Pts (Stanford Virco)
DRM drug resistance mutations
J Clin Micro 2001
43Genotypic Resistance Testing - II
Differences from Consensus B L10I, G17R, K20I,
E35D, N37S, M46I, I62V, L63P, A71I, G73S, I84V,
L90M, I93L
Level of resistance to each of the PIs
including dual PIs APV
NFV IDV RTV LPV
SQV ATV
44Drug Resistance Knowledge Base
- Which mutations are selected by treatment?
- In vitro (virus passage experiments)
- In vivo (in patients receiving the treatment)
- Which mutations cause phenotypic resistance in
vitro? - Laboratory isolates
- Clinical isolates
- Which mutations interfere with response to a new
treatment?
45Stanford HIV Drug Resistance Database
- http//hivdb.stanford.edu
- 27,000 virus isolates
- 12,000 individuals
- 24,000 drug susceptibility results
- 520 references
46Mutations Selected by Nelfinavir (NFV)
mutant in subtype B isolates from untreated
persons (n2400)
mutant in subtype B isolates from NFV-treated
persons (n360)
http//hivdb.stanford.edu
47Reduction in Abacavir Susceptibility with RT
Mutations at Positions 41, 184, 210, 215
Wildtype isolates
Mutant isolates
48Virologic Response to Salvage Therapy
49(No Transcript)
50PI Mutation Patterns in 4,183 Persons
Rhee SY et al AAC, 2004
51NRTI Mutation Patterns in 4,183 Persons
Rhee SY et al AAC, 2004
52NNRTI Mutation Patterns in 4,183 Persons
Rhee SY et al AAC, 2004
53Interactions Between HIV-1 RT Drug Resistance
Mutations
Compensatory reduction in AZT, d4T, and
TDF resistance in viruses containing T215Y/F
184 (3TC)
54NRTI-NNRTI Resistance Interactions
NNRTI Mutations (L100I, Y181C)
Compensatory reduction in AZT resistance
NRTI Mutations (41, 215 ...)
Compensatory reduction in NNRTI resistance
55Two Mechanisms of NRTI Resistance
- Loss of affinity of RT for the analog
- Examples M184V, Q151M, K65R, L74V
- Repair of the terminated DNA-chain
- pyrophosphorolysis, nucleotide excision,
primer unblocking - Classical AZT resistance mutations (TAMs)41,
67, 70, 210, 215, 219 - The loss of affinity mutations often interfere
with the primer unblocking mutations
56NRTI Susceptibility Testing
- Susceptibility testing works best for the PIs and
NNRTIs. - In contrast, the NRTIs are prodrugs that must be
triphosphorylated to become active. - Triphosphorylation occurs at different rates in
different cell types and the activated
lymphocytes used for susceptibility testing do
not provide the best assessment of drug activity
or loss of activity in vivo.
57Protease Cleavage Site Mutations
- HIV-1 protease specifically recognizes and
cleaves 9 protease cleavage sites (8-mers) in gag
and pol. - Mutations at these sites often develop as
compensatory changes to increase the replication
of viruses that contain PI-resistance mutations.
58Sequence Quality Control
- Molecular epidemiology
- Compare each nucleic acid sequence to all
sequences generated within the past several
weeks. - Compare the sequence to previous sequences from
the same patient.
59Sequence Analysis Programs HIVseq, HIVdb
Meaningful Results
(1) Quality control (2) Sequence
Interpretation (3) Literature references
Shafer, Jung, Betts Nature Medicine (11/2000)
60(No Transcript)
61HIVdb Program Output - I
62HIVdb Program Output - II
63HIVdb Program Output - III
64HIVdb Program Output - IV
- Each score is a link to data linking the mutation
to the drug
65Genotypic Resistance Interpretation
Concordance ANRS, HIVDB, Rega, VGI
Ravela et al. JAIDS 2003
66PI-Associated Mutations and Drug Resistance
Surveillance (Subtype B)
K20I is consensus for G and CRF02_AG V11I, L33F,
E35G, P74A/S, and L89I are polymorphic in one or
more non-B subtypes (range 1-4)
Rhee SY et al. submitted
67NRTI-Associated Mutations and Drug Resistance
Surveillance (Subtype B)
K43E is consensus for CRF01_AE E44D and T139M
are polymorphic in one or more non-B subtypes
(range 1-3)
Rhee SY et al. submitted
68NNRTI-Associated Mutations and Drug Resistance
Surveillance (Subtype B)
V179E occurred at a prevalence of 7 in subtype
G F227L occurred at a prevalence of 2 in
subtype F.
Rhee SY et al. submitted
69Subtypes and Drug Resistance
- Each of the current HIV drugs was developed by
targeting subtype B viruses. - Most in vitro studies and clinical data suggest
that current drugs are as active against subtype
B as they are against non-B viruses. - But there are few data on the genetic mechanisms
by which non-B viruses become resistant to
current HIV drugs. - Each of the known-drug resistance mutations has
been reported in at least one non-B isolate. - The patterns of mutations associated with
treatment failure may differ between the subtypes
70New Laboratory Tests
- Common
- Therapeutic drug levels (TDM)
- Replication capacity (RC)
- Experimental
- Host genetic factors
- HLA
- Chemokine receptor and chemokine variants
- CYP450 variants
- Other host cellular partners
- Virus tropism (X4, R5)
- Sequencing of PBMCs and minor variants
71Kilby and Eron, NEJM 2003
72Examples of Inhibitors of HIV-1 Cell Entry in
Development
Kilby, J. M. et al. N Engl J Med
20033482228-2238