Title: The Chemistry of Villin Gary Benz and Claudia Winkler
1The Chemistry of VillinGary Benz and Claudia
Winkler
2The Chemistry of Villin
- Villin is a protein
- Proteins are macromolecules (polymers) formed by
a defined sequence of small similar molecules
(monomers) of amino acids - Amino acids are organic compounds containing at
least one amino group (NH3) and one carboxyl
group (-COOH). - 20 different amino acids make up all proteins
3The amino-acid alphabet
- Biologists represent each amino acid with a
capital letter - For instance
- DAspartic Acid, EGlutamic Acid,
FPhenylalanine, KLysine, AAlanine, VValine,
FPhenylalanine - All amino acids are made of 4 elements Carbon,
Hydrogen, Oxygen, Nitrogen. Two also contain
Sulfur.
4Villins Single Chain
- Biologists describe the sequence of amino acids
that make villin as - DEDFKAVFGMTRSAFANLPLWKQQNLKKEKGLFMLS
- Although villin is made of a chain of 36 letters,
only 16 different letters are needed to describe
villin - In the next slides we shall look at the
individual amino acids that make up villin
5D Aspartic Acid
Name Info Looks
Aspartic acid, Letter D Abbreviation Asp 4 oxygen 4 carbon 6 hydrogen 1 nitrogen
6E Glutamic Acid
Name Info Looks
Glutamic acid Letter E Abbreviation Glu 5 carbon 8 hydrogen 4 oxygen 1 nitrogen
7F Phenylalanine
Name Info Looks
Phenylalanine Letter F Abbreviation Phe 9 carbon 11 hydrogen 1 nitrogen 2 oxygen
8K Lysine
Name Info Looks
Lysine Letter K Abbreviation Lys 6 carbon 14 hydrogen 2 nitrogen 2 oxygen
9A Alanine
Name Info Looks
Alanine Letter A Abbreviation Ala 3 carbon 7 hydrogen 1 nitrogen 2 oxygen
10V Valine
Name Info Looks
Valine Letter V Abbreviation Val 5 carbon 11 hydrogen 1 nitrogen 2 oxygen
11G Glycine
Name Info Looks
Glycine Letter G Abbreviation Gly 5 carbon 11 hydrogen 1 nitrogen 2 oxygen
12M Methionine
Name Info Looks
Methionine Letter M Abbreviation Met 5 carbon 11 hydrogen 1 nitrogen 2 oxygen 1 suphur
13T Threonine
Name Info Looks
Threonine Letter T Abbreviation Thr 4 carbon 9 hydrogen 1 nitrogen 3 oxygen
14R Arginine
Name Info Looks
Arginine Letter R Abbreviation Arg 6 carbon 14 hydrogen 4 nitrogen 2 oxygen
15S Serine
Name Info Looks
Serine Letter S Abbreviation Ser 3 carbon 7 hydrogen 1 nitrogen 3 oxygen
16N Asparagine
Name Info Looks
Asparagine Letter N Abbreviation Asn 4 carbon 8 hydrogen 2 nitrogen 3 oxygen
17L Leucine
Name Info Looks
Leucine Letter L Abbreviation Leu 6 carbon 13 hydrogen 1 nitrogen 2 oxygen
18P Proline
Name Info Looks
Proline Letter P Abbreviation Pro 5 carbon 9 hydrogen 1 nitrogen 2 oxygen
19W Tryptophan
Name Info Looks
Tryptophan Letter W Abbreviation Trp 11 carbon 12 hydrogen 2 nitrogen 2 oxygen
20Q Glutamine
Name Info Looks
Glutamine Letter Q Abbreviation Gln 5 carbon 10 hydrogen 2 nitrogen 3 oxygen
21Elements
- Carbon (C), Hydrogen (H), Oxygen (O), Nitrogen
(N) and Sulfur (S) are the only chemical elements
that make up all villins amino acids. - We shall review some of their properties in the
next pages.
22Carbon
- (Latin carbo, charcoal) Carbon, an element of
prehistoric discovery, is very widely distributed
in nature. It is found in abundance in the sun,
stars, comets, and atmospheres of most planets. - Carbon is the source of energy for life through
carbohydrates, just like a burning log is a
source of energy to a cold room.
Atomic number 6
Atomic Symbol C
Atomic mass 12.011 u
Electron Configuration He2s22p2
23Hydrogen
- (Greek hydro, water, and genes, forming)
Hydrogen is the most abundant of all elements in
the universe. - The heavier elements were originally made from
Hydrogen or from other elements that were
originally made from Hydrogen. - Used in rocket fuel.
Atomic number 1
Atomic symbol H
Atomic mass 1.0070 u
Electron Configuration 1s1
24Oxygen
- Greek oxys, sharp, acid, and genes, forming
acid former) Oxygen is the third most abundant
element found in the sun. Oxygen is vital to the
respiration of living organisms. - Oxygen is responsible for the bright red and
yellow-green colors of the Aurora. - Essential element for combustion (i.e. burning).
Atomic number 8
Atomic symbol O
Atomic mass 15.9994 u
Electron Configuration He2s22p4
25Nitrogen
- (Latin Nitrum, Greek. Nitron, native soda genes,
forming). - Nitrogen gas (N2) makes up 78.1 of the Earths
air, by volume. - Nitrogen is found in all living systems as part
of the makeup of biological compounds. - Ammonia (NH3) is the most important commercial
compound of nitrogen, with a very pungent smell,
used in cleaning supplies.
Atomic number 7
Atomic symbol N
Atomic mass 14.00674
Electron Configuration He2s22p3
26Sulfur
- (Sanskrit, sulvere Latin sulpur) Known to the
ancients referred to in Genesis as brimstone. - Sulfur occurs native in the vicinity of volcanoes
and hot springs. - It is widely distributed in nature in various
minerals (iron pyrites, galena, sphalerite,
cinnabar, stibnite, gypsum, epsom salts,
celestite, barite, etc.) - Sulfur is found in meteorites.
Atomic number 16
Atomic symbol S
Atomic mass 32.6
Electron Configuration Ne3s23p4
Yellowstone hot springs
27Molecules, Bonds
- Atoms are bonded together to form molecules and
molecules are bonded together to form
macromolecules. - The next slides shows some characteristics of
chemical bonds.
28Chemical Bonds
29Peptide Bond
- Amino acids join together via a special bond
called peptide bond. - In a peptide bond, two molecules (amino acid 1
and amino acid 2) are joined together with the
accompanying removal of a molecule of water.
30Activity
- Knowing that villin is made of the following
sequence of amino acids - DEDFKAVFGMTRSAFANLPLWKQQNLKKEKGLFMLS
- Compute the molar mass of villin.
- Compute the percentage by number of each atom
component. - Compute the percentage by mass of each atom
component. - (Remember that amino acids are joined together
through peptide bonds.) - Lesson Plan