Proposal: pHLIP generation in E.coli PowerPoint PPT Presentation

presentation player overlay
1 / 9
About This Presentation
Transcript and Presenter's Notes

Title: Proposal: pHLIP generation in E.coli


1
Proposal pHLIP generation in E.coli
  • By Brandon Lee and Ahad Waraich

2
What is pHLIP?
  • A peptide found in Bacteriorhodopsin.
  • pHLIP pH Low-insertion peptide molecule
  • Sequence AAEQNPIYWARYADWLFTTPLLLLDLALLVDADEGTCG
  • - At low pH environments, spontaneous insertion
    (into membrane bilayers) and formation of
    transbilayer alpha-helices occurs.

3
A Bit of History and Why we should care
  • pHLIP first discovered by the Donald M. Engelman
    group at Yale University and collaborating
    members from the University of Rhode Island.
  • High extracellular acidity is associated with
    many pathological conditions drug delivery and
    cell imaging can be done via pHLIP! High acidity
    is not observed in normal cellular environments
  • - tumors,
  • - infarcts,
  • - stroke-afflicted tissue,
  • - atherosclerotic lesions

4
How it works What happens
  • Forms transmembrane alpha-helix becomes rigid at
    low pH like nano-syringe
  • Inserts in low pH environments but only
    associates at pH gt 7.0 Triggered by the increase
    of the peptide hydrophobicity due to the
    protonation of Asp residues induced by low pH.
  • N terminus stays outside, C terminus of the
    peptide is translocated across the bilayer
  • - Previous experiments show that disulfide
    bonding to the c-terminus can be cleaved by
    reducing environment within cell. Can attach
    dyes or other molecules to this end.

5
Results of Several Studies Done
  • The delivery of phalloidin into cells by pHLIP.
    (a) Fluorescence images of HeLa cells incubated
    (for 1 h) with a pHLIPSSPhTRITC cleavable
    construct
  • (2 M) at pH 7.4
  • - Strong fluorescence of actin filaments was
    observed after pH 6.5
  • incubation.

Tumor and inflammation imaging - (b) Overlay of
pHLIP-Cy5.5 fluorescence and light images of mice
bearing a tumor (7mmin diameter, 12 d after 106
cell implant)
6
What remains to be known?
  • The size of molecules that can be attached to
    pHLIP remains to be known
  • Polarity of molecules that can be attached also
    remains to be studied
  • What available drugs and imaging techniques can
    we apply to this molecule?
  • Overall, this molecule has not been explored in
    too much detail

7
What can we do?
  • Recent experiments by the Engelman group have
    shown that near-infrared fluorescence imaging
    works in mouse cancers and rat inflammatory
    arthiritis models using pHLIP as a delivery
    device
  • NIR fluorescent dyes can be conjugated with Cys
    or Lys residues placed on pHLIP N-terminus
    (outside of cell upon insertion).
  • - Dyes that can be used
  • - Cy5.5 or Alexa750
  • Possibly initiatives
  • Since NIR range (700 900 nm) can propagate
    through tissues in organs and whole bodies, why
    not use this for early tumor detection?
  • Another direction Is there some way to make this
    delivery device easily accessible? Produced in
    large quantities?

8
Why Synthetic Biology?
  • pHLIP related to a peptide in bacteriorhodopsin
    found in halobacteria (not a model organism)
  • pHLIP has been created through solid-phase
    peptide synthesis (SPPS) via 9-fluorenylmethyloxyc
    arbonyl (FMOC) chemistry, purified via
    reverse-phase chromatography
  • FMOC solid-phase peptide synthesis Treat small,
    solid beads with linkers (functional units) that
    can be used to make peptide chains

9
Why Synthetic Biology?
  • SPPS may be limited by yield
  • Perhaps synthetic biology (generate it in E.
    coli, etc.) could be better
  • Even if there are no apparent problems with SPPS,
    there is no harm in trying to create the protein
    in a new way (like synthetic biology, with E.
    coli) something advantageous about a synthetic
    biology method could arise
Write a Comment
User Comments (0)
About PowerShow.com