Title: Eukaryotic mRNA processing
1Eukaryotic mRNA processing
- Alternative splicing
- Cap and Tail
2Alternative Splicing of Exons
Can result in related proteins
This version has all exons included
mmnvnavyakcvtpdeavtlitsgshlsgmfaaeppallnalakrakr
These versions have different exons included in
the final verison of the protein
mmnvnavyakcvtpdgmfaaeppallnalakrakr
eavtlitsgshlsgmfaaeppallnalakrakr
3Alternative splicing makes it possible for a
single gene to code for a number of different
variations of a protein. Splicing patterns can
be tissue-specific, so that a certain variation
of a protein is produced in a specific tissue.
4Gene Mutations
- Which is most harmful?
- Which is least harmful?
- What would happen if a base was inserted?