Title: Computational Molecular Biology
1Computational Molecular Biology
- Protein Structure Introduction and Prediction
2Protein Folding
- One of the most important problem in molecular
biology - Given the one-dimensional amino-acid sequence
that specifies the protein, what is the proteins
fold in three dimensions?
3Overview
- Understand protein structures
- Primary, secondary, tertiary
- Why study protein folding
- Structure can reveal functional information
which we cannot find from the sequence - Misfolding proteins can cause diseases mad cow
disease - Use in drug designs
4Overview of Protein Structure
- Proteins make up about 50 of the mass of the
average human - Play a vital role in keeping our bodies
functioning properly - Biopolymers made up of amino acids
- The order of the amino acids in a protein and the
properties of their side chains determine the
three dimensional structure and function of the
protein
5Amino Acid
- Building blocks of proteins
- Consist of
- An amino group (-NH2)
- Carboxyl group (-COOH)
- Hydrogen (-H)
- A side chain group (-R) attached to the central
a-carbon - There are 20 amino acids
- Primary protein structure is a sequence of a
chain of amino acids
Side chain
Aminogroup
Carboxylgroup
6Side chains (Amino Acids)
- 20 amino acids have side chains that vary in
structure, size, hydrogen bonding ability, and
charge. - R gives the amino acid its identity
- R can be simple as hydrogen (glycine) or more
complex such as an aromatic ring (tryptophan)
7Chemical Structure of Amino Acids
8How Amino Acids Become Proteins
Peptide bonds
9Polypeptide
- More than fifty amino acids in a chain are called
a polypeptide. - A protein is usually composed of 50 to 400 amino
acids. - We call the units of a protein amino acid
residues.
amidenitrogen
carbonylcarbon
10Side chain properties
- Carbon does not make hydrogen bonds with water
easily hydrophobic. - These water fearing side chains tend to
sequester themselves in the interior of the
protein - O and N are generally more likely than C to
h-bond to water hydrophilic - Ten to turn outward to the exterior of the
protein
11(No Transcript)
12Primary Structure
Primary structure Linear String of Amino Acids
Side-chain
Backbone
... ALA PHE LEU ILE LEU ARG ...
Each amino acid within a protein is referred to
as residues Each different protein has a unique
sequence of amino acid residues, this is its
primary structure
13Secondary Structure
- Refers to the spatial arrangement of contiguous
amino acid residues - Regularly repeating local structures stabilized
by hydrogen bonds - A hydrogen atom attached to a relatively
electronegative atom - Examples of secondary structure are the ahelix
and ßpleated-sheet
14Alpha-Helix
- Amino acids adopt the form of a right handed
spiral - The polypeptide backbone forms the inner part of
the spiral - The side chains project outward
- every backbone N-H group donates a hydrogen bond
to the backbone CÂ Â O group
15Beta-Pleated-Sheet
- Consists of long polypeptide chains called
beta-strands, aligned adjacent to each other in
parallel or anti-parallel orientation - Hydrogen bonding between the strands keeps them
together, forming the sheet - Hydrogen bonding occurs between amino and
carboxyl groups of different strands
16Parallel Beta Sheets
17Anti-Parallel Beta Sheets
18Mixed Beta Sheets
19Tertiary Structure
- The full dimensional structure, describing the
overall shape of a protein - Also known as its fold
20Quaternary Structure
- Proteins are made up of multiple polypeptide
chains, each called a subunit - The spatial arrangement of these subunits is
referred to as the quaternary structure - Sometimes distinct proteins must combine together
in order to form the correct 3-dimensional
structure for a particular protein to function
properly. - Example the protein hemoglobin, which carries
oxygen in blood. Hemoglobin is made of four
similar proteins that combine to form its
quaternary structure.
21Other Units of Structure
- Motifs (super-secondary structure)
- Frequently occurring combinations of secondary
structure units - A pattern of alpha-helices and beta-strands
- Domains A protein chain often consists of
different regions, or domains - Domains within a protein often perform different
functions - Can have completely different structures and
folds - Typically a 100 to 400 residues long
22What Determines Structure
- What causes a protein to fold in a particular
way? - At a fundamental level, chemical interactions
between all the amino acids in the sequence
contribute to a proteins final conformation - There are four fundamental chemical forces
- Hydrogen bonds
- Hydrophobic effect
- Van der Waal Forces
- Electrostatic forces
23Hydrogen Bonds
- Occurs when a pair of nucliophilic atoms such as
oxygen and nitrogen share a hydrogen between them - Pattern of hydrogen bounding is essential in
stabilizing basic secondary structures
24Van der Waal Forces
- Interactions between immediately adjacent atoms
- Result from the attraction between an atoms
nucleus and it neighbors electrons
25Electrostatic Forces
- Oppositely charged side chains con form
salt-bridges, which pulls chains together
26Experimental Determination
- Centralized database (to deposit protein
structures) called the protein Databank (PDB),
accessible at http//www.rcsb.org/pdb/index.html - Two main techniques are used to determine/verify
the structure of a given protein - X-ray crystallography
- Nuclear Magnetic Resonance (NMR)
- Both are slow, labor intensive, expensive
(sometimes longer than a year!)
27X-ray Crystallography
- A technique that can reveal the precise three
dimensional positions of most of the atoms in a
protein molecule - The protein is first isolated to yield a high
concentration solution of the protein - This solution is then used to grow crystals
- The resulting crystal is then exposed to an X-ray
beam
28Disadvantages
- Not all proteins can be crystallized
- Crystalline structure of a protein may be
different from its structure - Multiple maps may be needed to get a consensus
29NMR
- The spinning of certain atomic nuclei generates a
magnetic moment - NMR measures the energy levels of such magnetic
nuclei (radio frequency) - These levels are sensitive to the environment of
the atom - What they are bonded to, which atoms they are
close to spatially, what distances are between
different atoms - Thus by carefully measurement, the structure of
the protein can be constructed
30Disadvantages
- Constraint of the size of the protein an upper
bound is 200 residues - Protein structure is very sensitive to pH.
31Computational Methods
- Given a long and painful experimental methods,
need computational approaches to predict the
structure from its sequence.
32Functional Region Prediction
33Protein Secondary Structure
34Tertiary Structure Prediction
35More Details on X-ray Crystallography
36Overview
37Overview
38Crystal
- A crystal can be defined as an arrangement of
building blocks which is periodic in three
dimensions
39Crystallize a Protein
- Have to find the right combination of all the
different influences to get the protein to
crystallize - This can take a couple hundred or even thousand
experiments - Most popular way to conduct these experiments
- Hanging-drop method
40Hanging drop method
- The reservoir contains a precipitant
concentration twice as high as the protein
solution - The protein solutions is made up of 50 of stock
protein solution and 50 of reservoir solution - Overtime, water will diffuse from the protein
drop into the reservoir - Both the protein concentration and precipitant
concentration will increase - Crystals will appear after days, weeks, months
41Properties of protein crystal
- Very soft
- Mechanically fragile
- Large solvent areas (30-70)
42A Schematic Diffraction Experiment
43Why do we need Crystals
- A single molecule could never be oriented and
handled properly for a diffraction experiment - In a crystal, we have about 1015 molecules in the
same orientation so that we get a tremendous
amplification of the diffraction - Crystals produce much simpler diffraction
patterns than single molecules
44Why do we need X-rays
- X-rays are electromagnetic waves with a
wavelength close to the distance of atoms in the
protein molecules - To get information about where the atoms are, we
need to resolve them -gt thus we need radiation
45A Diffraction Pattern
46(No Transcript)
47Resolution
- The primary measure of crystal order/quality of
the model - Ranges of resolution
- Low resolution (gt3-5 Ao) is difficult to see the
side chains only the overall structural fold - Medium resolution (2.5-3 Ao)
- High resolution (2.0 Ao)
48Some Crystallographic Terms
- h,k,l Miller indices (like a name of the
reflection) - I(h,k,l) intensity
- 2? angle between the x-ray incident beam and
reflect beam
49Diffraction by a Molecule in a Crystal
- The electric vector of the X-ray wave forces the
electrons in our sample to oscillate with the
same wavelength as the incoming wave
50Description of Waves
51Structure Factor Equation
- fj proportional to the number of electrons this
atom j has - One of the fundamental equations in X-ray
Crystallography
52The Phase
- From the measurement, we can only obtain the
intensity I(hkl) of any given reflection (hkl) - The phase a(hkl) cannot be measured
53How to Determine the Phase
- Small changes are introduced into the crystal of
the protein of interest - Eg soaking the crystal in a solution containing
a heavy atom compound
- Second diffraction data set needs to be
collected - Comparing two data sets to determine the phases
(also able to localize the heavy atoms)
54Other Phase Determination Methods
55Electron Density Map
- Once we know the complete diffraction pattern
(amplitudes and phases), need to calculate an
image of the structure - The above equation returns the electron density
(so we get a map of where the electrons are their
concentration)
56Interpretation of Electron Density
- Now, the electron density has to be interpreted
in terms of atom identities and positions. - (1) packing of the whole molecules is shown in
the crystal - (2) a chain of seven amino acids in shown with
the resulting structure superimposed - (3) the electron density of a trypophan side
chain is shown
57Refinement and the R-Factor
58Nuclear Magnetic Resonance
- Concentrated protein solution (very purified)
- Magnetic field
- Effect of radio frequencies on the resonance of
different atoms is measured.
59(No Transcript)
60NMR
- Behavior of any atom is influenced by neighboring
atoms - more closely spaced residues are more perturbed
than distant residues - can calculate distances based on perturbation
61NMR spectrum of a protein
62Computational Molecular Biology
- Protein Structure Secondary Prediction
63Primary Structure Symbolic Definition
- A A,C,D,E,F,G,H,I,J,K,L,M,N,P,Q,R,S.T,V,W,Y
set of symbols denoting all amino acids - A - set of all finite sequences formed out of
elements of A, called protein sequences - Elements of A are denoted by x, y, z ..i.e. we
write x? A, y? A, z?A, etc - PROTEIN PRIMARY STRUCTURE any x ? A is also
called a protein sequence or protein sub-unit
64Protein Secondary Structure (PSS)
- Secondary structure the arrangement of the
peptide backbone in space. It is produced by
hydrogen bondings between amino acids - PROTEIN SECONDARY STRUCTURE consists of protein
sequence and its hydrogen bonding patterns
called SS categories
65Protein Secondary Structure
- Databases for protein sequences are expanding
rapidly - The number of determined protein structures (PSS
protein secondary structures) and the number of
known protein sequences is still limited - PSSP (Protein Secondary Structure Prediction)
research is trying to breach this gap.
66Protein Secondary Structure
- The most commonly observed conformations in
secondary structure are - Alpha Helix
- Beta Sheets/Strands
- Loops/Turns
67Turns and Loops
- Secondary structure elements are connected by
regions of turns and loops - Turns short regions of non-?, non-?
conformation - Loops larger stretches with no secondary
structure.
68Three secondary structure states
- Prediction methods are normally assessed for 3
states - H (helix)
- E (strands)
- L (others (loop or turn))
69Secondary Structure
- 8 different categories
- H ? - helix
- G 310 helix
- I ? - helix (extremely rare)
- E ? - strand
- B ? - bridge
- T ?- turn
- S bend
- L the rest
70Three SS states Reduction methods
- Method 1, used by DSSP program
- H(helix) G (310 helix), H (?- helix)
- E (strands) E (?-strand), B (?-bridge) ,
- L all the rest
- Shortly E,B gt E G,H gt H Rest gt C
- Method 2, used by STRIDE program
- H as in Method 1
- E E (?-strand), b (isolated ? -bridge),
- L all the rest
71Three SS states Reduction methods
- Method 3, used by DEFINE program
- H(helix) as in Method 1
- E (strands) E (?-strand),
- L all the rest
72Example of typical PSS Data
- Example
- Sequence
- KELVLALYDYQEKSPREVTHKKGDILTLLNSTNKDWWKYEYNDRQGFVP
- Observed SS
- HHHHHLLLLEEEHHHLLLEEEEEELLLHHHHHHHHLLLEEEEEELLLHHH
73PSS Symbolic Definition
- Given A A,C,D,E,F,G,H,I,J,K,L,M,N,P,Q,R,S.T,V,
W,Y set of symbols denoting amino acids and a
protein sequence x ? A - Let S H, E, L be the set of symbols of 3
states H (helix), E (strands) and L (loop) and
S be the set of all finite sequences of elements
of S. - We denote elements of S by e, e? S
74PSS Symbolic Definition
- Any one-to-one function
- f A? S i.e. f ? A x S
- is called a protein secondary structure (PSS)
identification function - An element (x, e) ? f is a called protein
secondary structure (of the protein sequence x) - The element e ? S (of (x, e) ? f ) is called
secondary structure.
75PSSP
- If a protein sequence shows clear similarity to a
protein of known three dimensional structure - then the most accurate method of predicting the
secondary structure is to align the sequences by
standard dynamic programming algorithms - Why?
- homology modelling is much more accurate than
secondary structure prediction for high levels of
sequence identity.
76PSSP
- Secondary structure prediction methods are of
most use when sequence similarity to a protein of
known structure is undetectable. - It is important that there is no detectable
sequence similarity between sequences used to
train and test secondary structure prediction
methods.
77Classification and Classifiers
- Given a database table DB with a special
atribute C, called a class attribute (or decision
attribute). The values C1, C2, ...Cn of the
class atrribute are called class labels. - Example
A1 A2 A3 A4 C
1 1 m g c1
0 1 v g c2
1 0 m b c1
78Classification and Classifiers
- The attribute C partitions the records in the DB
- divides the records into disjoint subsets
defined by the attributes C values, CLASSIFIES
the records. - It means we use the attributre C and its values
to divide the set R of records of DB into n
disjoint classes - C1 r?DB Cc1 ...... Cnr?DB Ccn
- Example (from our table)
- C1 (1,1,m,g), (1,0,m,b) r1,r3
- C2 (0,1,v,g) r2
79Classification and Classifiers
- An algorithm is called a classification algorithm
if it uses the data and its classification to
build a set of patterns. - Those patterns are structured in such a way that
we can use them to classify unknown sets of
objects- unknown records. - For that reason (because of the goal) the
classification algorithm is often called shortly
a classifier. - The name classifier implies more then just
classification algorithm. A classifier is final
product of a data set and a classification
algorithm.
80Classification and Classifiers
- Building a classifier consists of two phases
- training and testing.
- In both phases we use data (training data set
and disjoint with it test data set) for which the
class labels are known for ALL of the records. - We use the training data set to create patterns
- We evaluate created patterns with the use of of
test data, which classification is known. - The measure for a trained classifier accuracy is
called predictive accuracy. - The classifier is build i.e. we terminate the
process if it has been trained and tested and
predictive accuracy was on an acceptable level.
81Classifiers Predictive Accuracy
- PREDICTIVE ACCURACY of a classifier is a
percentage of well classified data in the testing
data set. - Predictive accuracy depends heavily on a choice
of the test and training data. - There are many methods of choosing test and and
training sets and hence evaluating the predictive
accuracy. This is a separate field of research.
82Accuracy Evaluation
- Use training data to adjust parameters of method
until it gives the best agreement between its
predictions and the known classes - Use the testing data to evaluate how well the
method works (without adjusting parameters!) - How do we report the performance?
- Average accuracy fraction of all test examples
that were classified correctly
83Accuracy Evaluation
- Multiple cross-validation test has to be
performed to exclude a potential dependency of
the evaluated accuracy on the particular test set
chosen - Jack-Knife
- Use 129 chains for setting up the tool (training
set) - 1 for estimating the performance (testing)
- This has to be repeated 130 times until each
protein has been used once for testing - The average over all 130 tests gives an estimate
of the prediction accuracy
84PSSP Datasets
- Historic RS126 dataset. Contains126 sub-units
with known secondary structure selected by Rost
and Sander. Today is not used anymore - CB513 dataset. Contains 513 sub-units with known
secondary structure selected by Cuff and Barton
in 1999. Used quite frencently in PSSP research - HS17771 dataset. Created by Hobohm and Scharf.
In March-2002 it contained 1771 sub-units -
- Lots of authors has their own and secret
datasets
85Measures for PSSP accuracy
- http//cubic.bioc.columbia.edu/eva/doc/measure_sec
.html (for more information) - Q3 Three-state prediction accuracy (percent of
succesful classified) - Qi obs How many of the observed residues were
correctly predicted? - Qi prd How many of the predicted residues were
correctly predicted?
86Measures for PSSP Accuracy
- Aij number of residues predicted to be in
structure type j and observed to be in type i - Number of residues predicted to be in structure
i - Number of residues observed to be in structure i
87Measures for SSP Accuracy
- The percentage of residues correctly predicted to
be in class i relative to those observed to be in
class i - The percentages of residues correctly predicted
to be in class i from all residues predicted to
be in i - Overall 3-state accuracy
88PSSP Algorithms
- There are three generations in PSSP algorithms
- First Generation based on statistical
information of single amino acids (1960s and
1970s) - Second Generation based on windows (segments) of
amino acids. Typically a window containes 11-21
amino acids (dominating the filed until early
1990s) - Third Generation based on the use of windows on
evolutionary information
89PSSP First Generation
- First generation PSSP systems are based on
statistical information on a single amino acid - The most relevant algorithms
- Chow-Fasman, 1974
- GOR, 1978
- Both algorithms claimed 74-78 of predictive
accuracy, but tested with better constructed
datasets were proved to have the predictive
accuracy 50 (Nishikawa, 1983)
90Chou-Fasman method
- Uses table of conformational parameters
determined primarily from measurements of the
known structure (from experimental methods) - Table consists of one likelihood for each
structure for each amino acid - Based on frequencies of residues in a-helices,
b-sheets and turns - Notation P(H) propensity to form alpha helices
- f(i) probability of being in position 1 (of a
turn)
91Chou-Fasman Pij-values
92Chou-Fasman
- A prediction is made for each type of structure
for each amino acid - Can result in ambiguity if a region has high
propensities for both helix and sheet (higher
value usually chosen)
93Chou-Fasman
- How it works
- 1. Assign all of the residues the appropriate set
of parameters - 2. Identify a-helix and b-sheet regions. Extend
the regions in both directions. - 3. If structures overlap compare average values
for P(H) and P(E) and assign secondary structure
based on best scores. - 4. Turns are calculated using 2 different
probability values.
94Assign Pij values
1. Assign all of the residues the appropriate
set of parameters
95Scan peptide for a-helix regions
2. Identify regions where 4 out of 6 have a
P(H) gt100 alpha-helix nucleus
96Extend a-helix nucleus
3. Extend helix in both directions until a set of
four consecutive residues with P(H) lt100.
Find sum of P(H) and sum of P(E) in the extended
region If region is long enough ( gt 5 letters)
and sum P(H) gt sum P(E) then declare the extended
region as alpha helix
97Scan peptide for b-sheet regions
4. Identify regions where 3 out of 5 have a
P(E) gt100 b-sheet nucleus 5. Extend b-sheet
until 4 continuous residues with an average P(E)
lt 100 6. If region average gt 100 and the
average P(E) gt average P(H) then b-sheet
98Overlapping
- Resolving overlapping alpha helix beta sheet
- Compute sum of P(H) and sum of P(E) in the
overlap. - If sum P(H) gt sum P(E) gt alpha helix
- If sum P(E) gt sum P(H) gt beta sheet
99Turn Prediction
- An amino acid is predicted as turn if all of the
following holds - f(i)f(i1)f(i2)f(i3) gt 0.000075
- Avg(P(ik)) gt 100, for k0, 1, 2, 3
- Sum(P(t)) gt Sum(P(H)) and Sum(P(E)) for ik,
(k0, 1, 2, 3)
100PSSP Second Generation
- Based on the information contained in a window of
amino acids (11-21 aa.) - The most systems use algorithms based on
- Statistical information
- Physico-chemical properties
- Sequence patterns
- Graph-theory
- Multivariante statistics
- Expert rules
- Nearest-neighbour algorithms
101PSSP First Second Generation
- Main problems
- Prediction accuracy lt70
- SS assigments differ even between crystals of the
same protein - SS formation is partially determined by
long-range interactions, i.e., by contacts
between residues that are not visible by any
method based on windows of 11-21 adjacent residues
102PSSP First Second Generation
- Main problems
- Prediction accuracy for b-strand 28-48, only
slightly better than random - beta-sheet formation is determined by more
nonlocal contacts than in alpha-helix formation - Predicted helices and strands are usually too
short - Overlooked by most developers
103Example of Second Generation
- Example for typical secondary structure
prediction of the 2nd generation. - The protein sequence (SEQ ) given was the SH3
structure. - The observed secondary structure (OBS ) was
assigned by DSSP (H helix E strand blank
non-regular structure the dashes indicate the
continuation). - The typical prediction of too short segments (TYP
) poses the following problems in practice. - (i) Are the residues predicted to be strand in
segments 1, 5, and 6 errors, or should the
helices be elongated? - (ii) Should the 2nd and 3rd strand be joined, or
should one of them be ignored, or does the
prediction indicate two strands, here? Note the
three-state per-residue accuracy is 60 for the
prediction given.
104PSSP Third Generation
- PHD First algorithm in this generation (1994)
- Evolutionary information improves the prediction
accuracy to 72 - Use of evolutionary information
- 1. Scan a database with known sequences with
alignment methods for finding similar sequences - 2. Filter the previous list with a threshold to
identify the most significant sequences - 3. Build amino acid exchange profiles based on
the probable homologs (most significant
sequences) - 4. The profiles are used in the prediction,
i.e. in building the classifier
105PSSP Third Generation
- Many of the second generation algorithms have
been updated to the third generation
106PSSP Third Generation
- Due to the improvement of protein information in
databases i.e. better evolutionary information,
todays predictive accuracy is 80 - It is believed that maximum reachable accuracy is
88. Why such conjecture?
107Why 88
- SS assignments may vary for two versions of the
same structure - Dynamic objects with some regions being more
mobile than others - Assignment differ by 5-15 between different
X-ray (NMR) versions of the same protein - Assignment diff. by about12 between structural
homologues - B. Rost, C. Sander, and R. Schneider, Redefining
the goals of protein secondary structure
predictions, J. Mol. Bio.
108PSSP Data Preparation
- Public Protein Data Sets used in PSSP research
contain protein secondary structure sequences. In
order to use classification algorithms we must
transform secondary structure sequences into
classification data tables. - Records in the classification data tables are
called, in PSSP literature (learning) instances. - The mechanism used in this transformation process
is called window. - A window algorithm has a secondary structure as
input and returns a classification table set of
instances for the classification algorithm.
109Window
- Consider a secondary structure (x, e).
- where (x,e) (x1x2 xn, e1e2en)
- Window of the length w chooses a subsequence of
length w of x1x2 xn, and an element ei from
e1e2en, corresponding to a special position in
the window, usually the middle - Window moves along the sequences
- x x1x2 xn and e e1e2en
- simultaneously, starting at the beginning moving
to the right one letter at the time at each step
of the process.
110Window Sequence to Structure
- Such window is called sequence to structure
window. We will call it for short a window. - The process terminates when the window or its
middle position reaches the end of the sequence
x. - The pair (subsequence, element of e ) is often
written in a form - subsequence ? H, E or L
- is called an instance, or a rule.
111Example Window
- Consider a secondary structure (x, e) and the
window of length 5 with the special position in
the middle (bold letters) - Fist position of the window is
- x A R N S T V V S T A A .
- e H H H H L L L E E E
- Window returns instance
- A R N S T ? H
112Example Window
- Second position of the window is
- x A R N S T V V S T A A .
- e H H H H L L L E E E
- Windows returns instance
- R N S T V ? H
- Next instances are
- N S T V V ? L
- S T V V S ? L
- T V V S T ? L
113Symbolic Notation
- Let f be a protein secondary structure (PSS)
identification function - f A? S i.e. f ? A x S
- Let x x1x2xn, e e1e2en, f(x) e, we define
- f(x1x2xn)xi ei, i.e. f(x)xi ei
114ExampleSemantics of Instances
- Let
- x A R N S T V V S T A A .
- e H H H H L L L E E E
- And assume that the windows returns an instance
- A R N S T ? H
- Semantics of the instance is
- f(x)NH,
- where f is the identification function and N is
preceded by A R and followed by S T and the
window has the length 5
115Classification Data Base (Table)
- We build the classification table with attributes
being the positions p1, p2, p3, p4, p5 .. pw - in the window, where w is length of the
window. - The corresponding values of attributes are
elements of of the subsequent on the given
position. - Classification attribute is S with values in the
set H, E, L assigned by the window operation
(instance, rule). - The classification table for our example (first
few records) is the following.
116Classification Table (Example)
- x A R N S T V V S T A A .
- e H H H H L L L E E E
p1 p2 p3 p4 p5 S
A R N S T H
R N S T V H
N S T V V L
S T V V S L
Semantics of record r r(p1, p2, p3,p4,p5, S) is
f(x)Vp3 Vs where Va denotes a value of
the attribute a.
117Size of classification datasets (tables)
- The window mechanism produces very large datasets
- For example window of size 13 applied to the
CB513 dataset of 513 protein subunits produces
about - 70,000 records (instances)
118Window
- Window has the following parameters
- PARAMETER 1 i ? N, the starting point of the
window as it moves along the sequence x x1 x2
. xn. The value i1 means that window starts
at x1, i5 means that window starts at x5 - PARAMETER 2 w ? N denotes the size (length)
of the window. - For example the PHD system of Rost and Sander
(1994) uses two window sizes 13 and 17.
119Window
- PARAMETER 3 p ? 1,2, , w
- where p is a special position of the window
that returns the classification attribute values
from S H, E, L and w is the size (length) of
the window - PSSP PROBLEM
- find optimal size w, optimal special position
p for the best prediction accuracy
120Window Symbolic Definition
- Window Arguments window parameters and secondary
structure (x,e) - Window Value (subsequence of x, element of e)
- OPERATION (sequence to structure window)
- W is a partial function
- W N ? N ? 1,, k ?(A ? S ) ? A ? S
- W(i, k, p, (x,e)) (xi x(i1). x(ik-1),
f(x)x(ip)) where (x,e) (x1x2 ..xn, e1e2en)
121Neural network models
- machine learning approach
- provide training sets of structures (e.g.
a-helices, non a -helices) - are trained to recognize patterns in known
secondary structures - provide test set (proteins with known structures)
- accuracy 70 75
122Reasons for improved accuracy
- Align sequence with other related proteins of the
same protein family - Find members that has a known structure
- If significant matches between structure and
sequence assign secondary structures to
corresponding residues
1233 State Neural Network
124Neural Network
125Input Layer
- Most of approach set w 17. Why?
- Based on evidence of statistical correlation with
secondary structure as far as 8 residues on
either side of the prediction point - The input layer consists of
- 17 blocks, each represent a position of window
- Each block has 21 units
- The first 20 units represent the 20 aa
- One to provide a null input used when the moving
window overlaps the amino- or carboxyl-terminal
end of the protein
126Binary Encoding Scheme
- Example
- Let w 5, and let say we have the sequence
- A E G K Q.
- Then the input layer is
- A,C,D,E,F,G,,N,P,Q,R,S.T,V,W,Y
- 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 . 0 0
- 0 0 1 0 ..
- 0 0 1 0 ..
127Hidden Layer
- Represent the structure of the central aa
- Encoding scheme
- Can use two units to present
- (1,0) H, (0,1) E, (0,0) L
- Some uses three units
- (1,0,0) H, (0,1,0) E, (0,0,1) L
- For each connection, we can assign some weight
value. - This weight value can be adjusted to best fit the
data (training)
128Output Level
- Based on the hidden level and some function f,
calculate the output. - Helix is assigned to any group of 4 or more
contiguous residues - Having helix output values greater than sheet
outputs and greater than some threshold t - Strand (E) is assigned to any group of two or
more contiguous resides, having sheet output
values greater than helix outputs and greater
than t - Otherwise, assigned to L
- Note that t can be adjusted as well (training)
129How PHD works
- Step 1. BLAST search with input sequence
- Step 2. Perform multiple seq. alignment and
calculate aa frequencies for each position
130How PHD works
- Step 3. First Level Sequence to structure net
- Input alignment profile, Output units for H,
E, L - Calculate occurrences of any of the residues
to be present in either an a-helix, b-strand, or
loop.
1 2 3 4 5 6 7
H 0.05 E 0.18 L 0.67
N0.2, S0.4, A0.4
131How PHD works
- Step 3. Second Level Structure to structure
net - Input First Level values, Output units for H,
E, L - Window size 17
H 0.59 E 0.09 L 0.31
E0.18
Step 4. Decision level
132Prepare Data for PHD Neural Nets
- Starting from a sequence of unknown structure
(SEQUENCE ) the following steps are required to
finally feed evolutionary information into the
PHD neural networks - a data base search for homologues (method Blast),
- a refined profile-based dynamic-programming
alignment of the most likely homologues (method
MaxHom) - a decision for which proteins will be considered
as homologues (length-depend cut-off for pairwise
sequence identity) - a final refinement, and extraction of the
resulting multiple alignment. Numbers 1-3
indicate the points where users of the
PredictProtein service can interfere to improve
prediction accuracy without changes made to the
final prediction method PHD . - http//cubic.bioc.columbia.edu/papers/2000_rev_hum
ana/paper.html
133PHD Neural Network
134Prediction Accuracy
135Where can I learn more?
- Protein Structure Prediction Center
- Biology and Biotechnology Research
ProgramLawrence Livermore National Laboratory,
Livermore, CA - http//predictioncenter.llnl.gov/Center.html
DSSP Database of Secondary Structure
Prediction http//www.sander.ebi.ac.uk/dssp/
136Computational Molecular Biology
- Protein Structure Tertiary Prediction via
Threading
137Objective
- Study the problem of predicting the tertiary
structure of a given protein sequence
138A Few Examples
actual
predicted
predicted
actual
actual
actual
predicted
predicted
139Two Comparative Modeling
- Homology modeling identification of homologous
proteins through sequence alignment structure
prediction through placing residues into
corresponding positions of homologous structure
models - Protein threading make structure prediction
through identification of good
sequence-structure fit - We will focus on the Protein Threading.
140Why it Works?
- Observations
- Many protein structures in the PDB are very
similar - Eg many 4-helical bundles, globins in the set
of solved structure - Conjecture
- There are only a limited number of unique
protein folds in nature
141Threading Method
- General Idea
- Try to determine the structure of a new sequence
by finding its best fit to some fold in library
of structures - Sequence-Structure Alignment Problem
- Given a solved structure T for a sequence t1t2tn
and a new sequence S s1s2 sm, we need to find
the best match between S and T
142What to Consider
- How to evaluate (score) a given alignment of s
with a structure T? - How to efficiently search over all possible
alignments?
143Three Main Approaches
- Protein Sequence Alignment
- 3D Profile Method
- Contact Potentials
144Protein Sequence Alignment Method
- Align two sequences S and T
- If in the alignment, si aligns with tj, assign si
to the position pj in the structure - Advantages
- Simple
- Disadvantages
- Similar structures have lots of sequence
variability, thus sequence alignment may not be
very helpful
1453D Profile Method
- Actually uses structural information
- Main idea
- Reduce the 3D structure to a 1D string describing
the environment of each position in the protein.
(called the 3D profile (of the fold)) - To determine if a new sequence S belongs to a
given fold T, we align the sequence with the
folds 3D profile - First question How to create the 3D profile?
146Create the 3D Profile
- For a given fold, do
- For each residue, determine
- How buried is it?
- Fraction of surrounding environment that is polar
- What secondary structure is it in (alpha-helix,
beta-sheet, or neither)
147Create the 3D profile
- 2. Assign an environment class to each position
- Six classes describe the burial and polarity
criteria (exposed, partially buried, very buried,
different fractions of polar environment)
148Create the 3D Profile
- These environment classes depend on the number of
surrounding polar residues and how buried the
position is. - There are 3 SS for each of these, thus have 18
environment classes
149Create the 3D Profile
- 3. Convert the known structure T to a string of
environment descriptors - 4. Align the new sequence S with E using dynamic
programming
150Scores for Alignment
- Need scores for aligning individual residues with
environments. - Key Different aa prefer diff. environment. Thus
determine scores by looking at the statistical
data
151Scores for Alignment
- Choose a database of known structures
- Tabulate the number of times we see a particular
residue in a particular environment class -gt
compute the score for each env class and each aa
pair - Choose gap penalties, eg. may charge more for
gaps in alpha and beta environments
152Alignment
- This gives us a table of scores for aligning an
aa sequence with an environment string - Using this scoring and Dynamic Programming, we
can find an optimal alignment and score for each
fold in our library - The fold with the highest score is the best fold
for the new sequence
153Contact Potentials Method
- Take 3D structure into account more carefully
- Include information about how residues interact
with each other - Consider pairwise interactions between the
position pi, pj in the fold - For a given alignment, produce a score which is
the sum over these interactions
154Problem
- Have a sequence from the database T t1tn with
known positions p1pn, and a new sequence S
s1sm. - Find 1 lt r1 lt r2 lt lt rn lt m which maximize
- where ri is the index of the aa in S which
occupies position pi - This problem is NP-complete for pairwise
interactions
155How to Define that Score?
- Use so-called knowledge-based potentials, which
comes from databases of observed interactions. - The general form
156How to Define the Score
- General Idea
- Define cutoff parameter for contact (e.g. up to
6 Angstroms) - Use the PDB to count up the number of times aa i
and j are in contact - Several method for normalization. Eg.
Normalization is by hypothetical random
frequencies
157Other Variations
- Many other variations in defining the potentials
- In addition to pairwise potentials, consider
single residue potentials - Distance-dependent intervals
- Counting up pairwise contacts separately for
intervals within 1 Angstrom, between 1 and 2
Angstroms
158Threading via Tree-Decomposition
159Contact Graph
- Each residue as a vertex
- One edge between two residues if their spatial
distance is within given cutoff. - Cores are the most conserved segments in the
template
template
160Simplified Contact Graph
161Alignment Example
162Alignment Example
163Calculation of Alignment Score
164Graph Labeling Problem
- Each core as a vertex
- Two cores interact if there is an interaction
between any two residues, each in one core - Add one edge between two cores that interact.
h
f
b
d
s
m
c
a
e
i
j
k
l
Each possible sequence alignment position for a
single core can be treated as a possible label
assignment to a vertex in G Di be a set of
all possible label assignments to vertex i. Then
for each label assignment A(i) in Di, we have
165Tree Decomposition
166Tree DecompositionRobertson Seymour, 1986
Greedy minimum degree heuristic
h
- Choose the vertex with minimum degree
- The chosen vertex and its neighbors form a
component - Add one edge to any two neighbors of the chosen
vertex - Remove the chosen vertex
- Repeat the above steps until the graph is empty
167Tree Decomposition (Contd)
Tree Decomposition
168Tree Decomposition-Based Algorithms
- Bottom-to-Top Calculate the minimal F function
- 2. Top-to-Bottom Extract the optimal assignment
A tree decomposition rooted at Xr
The score of component Xi
The scores of subtree rooted at Xl
The score of subtree rooted at Xi
The scores of subtree rooted at Xj