5,000+ Tertiary Structure PPTs View free & download

Protein Structures 2' Tertiary Structure PowerPoint PPT Presentation

Protein Structures 2' Tertiary Structure - Protein Structures. 2. Tertiary Structure. Protein Tertiary ... Tenebrio Molitor (beetle) The Rossman Fold. Alternate beta / alpha motif. Always right handed ...

Protein Structures. 2. Tertiary Structure. Protein Tertiary ... Tenebrio Molitor (beetle) The Rossman Fold. Alternate beta / alpha motif. Always right handed ...

| PowerPoint PPT presentation | free to view

Tema 14. Bases of protein structure and structural prediction. Structural data bank. Protein Data Ba PowerPoint PPT Presentation

Tema 14. Bases of protein structure and structural prediction. Structural data bank. Protein Data Ba - Clasification: SCOP, CATH. PDBSUM. CATH Hierarchy. C: Class (secondary structure content) ... SCOP. Structural Classification of Proteins. Family. Clear evolutive relationship ...

Clasification: SCOP, CATH. PDBSUM. CATH Hierarchy. C: Class (secondary structure content) ... SCOP. Structural Classification of Proteins. Family. Clear evolutive relationship ...

| PowerPoint PPT presentation | free to view

Structure Prediction (I): Secondary structure DNA/Protein structure-function analysis and prediction Lecture 7 - Title: PowerPoint Presentation Author: heringa Last modified by: heringa Created Date: 2/20/2003 6:08:47 PM Document presentation format: Custom Company

Title: PowerPoint Presentation Author: heringa Last modified by: heringa Created Date: 2/20/2003 6:08:47 PM Document presentation format: Custom Company

| PowerPoint PPT presentation | free to view

Tertiary Structures PowerPoint PPT Presentation

Tertiary Structures - Interior contains mostly hydrophobic residues which stabilize structure, ... sheets have a crossover strand, which usually is a 'right handed connection' ...

Interior contains mostly hydrophobic residues which stabilize structure, ... sheets have a crossover strand, which usually is a 'right handed connection' ...

| PowerPoint PPT presentation | free to view

Tertiary Structure PowerPoint PPT Presentation

Tertiary Structure - Tertiary Structure. Globular proteins (enzymes, molecular ... Recent discovery that amyloid diseases (eg. CJD, Alzheimer) are due to unstable protein folding ...

Tertiary Structure. Globular proteins (enzymes, molecular ... Recent discovery that amyloid diseases (eg. CJD, Alzheimer) are due to unstable protein folding ...

| PowerPoint PPT presentation | free to download

Protein Tertiary Structure Prediction PowerPoint PPT Presentation

Protein Tertiary Structure Prediction - Structural Bioinformatics Protein Tertiary Structure Prediction Applying Differential Geometry for DNA and RNA function prediction Frequency of points RNA binding ...

Structural Bioinformatics Protein Tertiary Structure Prediction Applying Differential Geometry for DNA and RNA function prediction Frequency of points RNA binding ...

| PowerPoint PPT presentation | free to view

Protein Tertiary Structure PowerPoint PPT Presentation

Protein Tertiary Structure - Protein Tertiary Structure. Protein Tertiary Structure. Packing ... Example: Helix B and G in myoglobin. Example: Helix B and G in myoglobin. Backbone only ...

Protein Tertiary Structure. Protein Tertiary Structure. Packing ... Example: Helix B and G in myoglobin. Example: Helix B and G in myoglobin. Backbone only ...

| PowerPoint PPT presentation | free to view

Chapter 4.3: Protein Tertiary and Quaternary Structures PowerPoint PPT Presentation

Chapter 4.3: Protein Tertiary and Quaternary Structures - Chapter 4.3: Protein Tertiary and Quaternary Structures CHEM 7784 Biochemistry Professor Bensley FIGURE 4-22 Quaternary structure of deoxyhemoglobin.

Chapter 4.3: Protein Tertiary and Quaternary Structures CHEM 7784 Biochemistry Professor Bensley FIGURE 4-22 Quaternary structure of deoxyhemoglobin.

| PowerPoint PPT presentation | free to view

Tertiary and Quaternary structures of proteins PowerPoint PPT Presentation

Tertiary and Quaternary structures of proteins - Supersecondary structures, motifs or folds, are particularly ... Removal of denaturing agents can lead to refolding of the secondary structure-renaturation. ...

Supersecondary structures, motifs or folds, are particularly ... Removal of denaturing agents can lead to refolding of the secondary structure-renaturation. ...

| PowerPoint PPT presentation | free to view

Chapter 4:The tertiary structure of proteins' PowerPoint PPT Presentation

Chapter 4:The tertiary structure of proteins' - The gene determines the primary structure. ... Blue = hydrophobic. Slice through a protein. 3. Disulfide bonds. 3. Disulfide bonds ...

The gene determines the primary structure. ... Blue = hydrophobic. Slice through a protein. 3. Disulfide bonds. 3. Disulfide bonds ...

| PowerPoint PPT presentation | free to view

Mining RNA Tertiary Motifs with Structure Graphs PowerPoint PPT Presentation

Mining RNA Tertiary Motifs with Structure Graphs - Department of Electrical Engineering and Computer Science, University of Kansas. 3 ... Quantile-Quantile plot for first node in motif #12. 26. 26. Statistical Analysis ...

Department of Electrical Engineering and Computer Science, University of Kansas. 3 ... Quantile-Quantile plot for first node in motif #12. 26. 26. Statistical Analysis ...

| PowerPoint PPT presentation | free to view

Factors Determining Secondary and Tertiary Structure - Factors Determining Secondary and Tertiary Structure

Factors Determining Secondary and Tertiary Structure

| PowerPoint PPT presentation | free to view

Bioinformatics master course DNA/Protein structure-function analysis and prediction Lecture 1: Protein Structure Basics (1) PowerPoint PPT Presentation

Bioinformatics master course DNA/Protein structure-function analysis and prediction Lecture 1: Protein Structure Basics (1) - Title: PowerPoint Presentation Author: heringa Last modified by: gebruiker Created Date: 2/3/2003 6:56:45 PM Document presentation format: On-screen Show

Title: PowerPoint Presentation Author: heringa Last modified by: gebruiker Created Date: 2/3/2003 6:56:45 PM Document presentation format: On-screen Show

| PowerPoint PPT presentation | free to download

Protein Folding: Interrelation between Secondary and Tertiary Structure Determination PowerPoint PPT Presentation

Protein Folding: Interrelation between Secondary and Tertiary Structure Determination - Protein Folding: Interrelation between Secondary and Tertiary ... and Department of Chemistry. University of Chicago. KITPC, Beijing ... Chou and Fasman ...

Protein Folding: Interrelation between Secondary and Tertiary ... and Department of Chemistry. University of Chicago. KITPC, Beijing ... Chou and Fasman ...

| PowerPoint PPT presentation | free to view

Bioinformatics master course DNA/Protein structure-function analysis and prediction Lecture 1: Protein Structure Basics (1) - Bioinformatics master course. DNA/Protein structure-function analysis and prediction ... http://www.few.vu.nl/onderwijs/roosters/rooster-vak-januari07.html ...

Bioinformatics master course. DNA/Protein structure-function analysis and prediction ... http://www.few.vu.nl/onderwijs/roosters/rooster-vak-januari07.html ...

| PowerPoint PPT presentation | free to download

From Visualization to Manipulation of Secondary and Tertiary RNA Structures PowerPoint PPT Presentation

From Visualization to Manipulation of Secondary and Tertiary RNA Structures - David Auber University of Bordeaux. Laurence Nigay University of Grenoble. France. Introduction ... performs a wide range of functions in biological systems ...

David Auber University of Bordeaux. Laurence Nigay University of Grenoble. France. Introduction ... performs a wide range of functions in biological systems ...

| PowerPoint PPT presentation | free to view

The third level of protein conformation is known as tertiary structure - The third level of protein conformation is known as tertiary structure

The third level of protein conformation is known as tertiary structure

| PowerPoint PPT presentation | free to view

Protein Structure PowerPoint PPT Presentation

Protein Structure - Protein Structure Primary - sequence of amino acids Secondary folding into pleated sheets or alpha helix Tertiary 3-D structure, completely folded

Protein Structure Primary - sequence of amino acids Secondary folding into pleated sheets or alpha helix Tertiary 3-D structure, completely folded

| PowerPoint PPT presentation | free to download

Protein Structures: Data Representation PowerPoint PPT Presentation

Protein Structures: Data Representation - Protein Structures: Data Representation Primary Structure: character string. Secondary Structure: Tertiary Structure: Quaternary Structure: Identifying sub-structures ...

Protein Structures: Data Representation Primary Structure: character string. Secondary Structure: Tertiary Structure: Quaternary Structure: Identifying sub-structures ...

| PowerPoint PPT presentation | free to download

Tertiary%20Structure PowerPoint PPT Presentation

Tertiary%20Structure - Tertiary Structure A result of interactions between side (R) chains that are widely separated within the peptide chain Covalent disulfide bonds - between 2 cysteine AA

Tertiary Structure A result of interactions between side (R) chains that are widely separated within the peptide chain Covalent disulfide bonds - between 2 cysteine AA

| PowerPoint PPT presentation | free to view

Macromolecular structure PowerPoint PPT Presentation

Macromolecular structure - Bioinformatics Macromolecular structure Contents Determination of protein structure Structure databases Secondary structure elements (SSE) Tertiary structure ...

Bioinformatics Macromolecular structure Contents Determination of protein structure Structure databases Secondary structure elements (SSE) Tertiary structure ...

| PowerPoint PPT presentation | free to download

Structural Bioinformatics PowerPoint PPT Presentation

Structural Bioinformatics - Primary structure = Secondary structure, Tertiary structure = Function ... Level of abstraction highly indicative of function. Databases: PDB, SCOP, CATH, FSSP ...

Primary structure = Secondary structure, Tertiary structure = Function ... Level of abstraction highly indicative of function. Databases: PDB, SCOP, CATH, FSSP ...

| PowerPoint PPT presentation | free to view

Protein structure - Protein structure Amino acid structure Amino acid bonds to make peptide Primary structure sequence of a chain of amino acids Primary structure Secondary structure ...

Protein structure Amino acid structure Amino acid bonds to make peptide Primary structure sequence of a chain of amino acids Primary structure Secondary structure ...

| PowerPoint PPT presentation | free to download

Protein Structure: Xray Crystallography PowerPoint PPT Presentation

Protein Structure: Xray Crystallography - To review the basics of protein structure (primary, secondary, supersecondary, tertiary) Understand the basic principles and steps in protein crystallization and ...

To review the basics of protein structure (primary, secondary, supersecondary, tertiary) Understand the basic principles and steps in protein crystallization and ...

| PowerPoint PPT presentation | free to view

PROTEIN STRUCTURES PowerPoint PPT Presentation

PROTEIN STRUCTURES - ... PRIMARY STRUCTURE This diagram shows the primary structure of PIG INSULIN, a protein hormone as ... Acids in the chain SECONDARY STRUCTURE Secondary ...

... PRIMARY STRUCTURE This diagram shows the primary structure of PIG INSULIN, a protein hormone as ... Acids in the chain SECONDARY STRUCTURE Secondary ...

| PowerPoint PPT presentation | free to view

Protein structures - Protein structures Protein Structure Why protein structure? The basics of protein Basic measurements for protein structure Levels of protein structure Prediction of ...

Protein structures Protein Structure Why protein structure? The basics of protein Basic measurements for protein structure Levels of protein structure Prediction of ...

| PowerPoint PPT presentation | free to download

Structural proteomics PowerPoint PPT Presentation

Structural proteomics - Structural proteomics Handouts. Proteomics section from book already assigned.

Structural proteomics Handouts. Proteomics section from book already assigned.

| PowerPoint PPT presentation | free to download

Storage and File Structure PowerPoint PPT Presentation

Storage and File Structure - Storage and File Structure Overview of Physical Storage Media Magnetic Disks RAID Tertiary Storage Storage Access File Organization Organization of Records in Files

Storage and File Structure Overview of Physical Storage Media Magnetic Disks RAID Tertiary Storage Storage Access File Organization Organization of Records in Files

| PowerPoint PPT presentation | free to download

Respiratory Structures PowerPoint PPT Presentation

Respiratory Structures - Respiratory Structures Nose: part of the upper respiratory tract, it ... has cardiac impression and has only two lobes: superior and inferior Peanut Butter Jelly Time!

Respiratory Structures Nose: part of the upper respiratory tract, it ... has cardiac impression and has only two lobes: superior and inferior Peanut Butter Jelly Time!

| PowerPoint PPT presentation | free to download

Protein Structure 1 PowerPoint PPT Presentation

Protein Structure 1 - Protein Structure 1 Primary and Secondary Structure Proteins fold into the local minimum free energy structure defined by their primary sequence.

Protein Structure 1 Primary and Secondary Structure Proteins fold into the local minimum free energy structure defined by their primary sequence.

| PowerPoint PPT presentation | free to download

Protein structure - Protein structure

Protein structure

| PowerPoint PPT presentation | free to view

Alps structure and tectonics PowerPoint PPT Presentation

Alps structure and tectonics - Alps structure and tectonics. Tertiary Collision between Italian Peninsula and Central Europe ... Late Cretaceous, precollisional plate-tectonic geometry ...

Alps structure and tectonics. Tertiary Collision between Italian Peninsula and Central Europe ... Late Cretaceous, precollisional plate-tectonic geometry ...

| PowerPoint PPT presentation | free to view

DNA structure- Part II PowerPoint PPT Presentation

DNA structure- Part II - DNA structure- Part II Levels of DNA structure * 2-*

DNA structure- Part II Levels of DNA structure * 2-*

| PowerPoint PPT presentation | free to download

Protein Structure Prediction - Protein Structure Prediction

Protein Structure Prediction

| PowerPoint PPT presentation | free to view

Protein Structure Prediction - Protein Structure Prediction Sequence database searching Domain assignment Multiple sequence alignment Comparative or homology modeling Secondary structure prediction

Protein Structure Prediction Sequence database searching Domain assignment Multiple sequence alignment Comparative or homology modeling Secondary structure prediction

| PowerPoint PPT presentation | free to view

Protein Structure Prediction - Protein Structure Prediction PHD: Network 1 Sequence Structure 13x20 values 3 values Pa(i) Pb(i) Pc(i) Network1 PHD: Network 2 Structure Structure 3 values Pa(i ...

Protein Structure Prediction PHD: Network 1 Sequence Structure 13x20 values 3 values Pa(i) Pb(i) Pc(i) Network1 PHD: Network 2 Structure Structure 3 values Pa(i ...

| PowerPoint PPT presentation | free to download

Plant Structure - Plant Structure

Plant Structure

| PowerPoint PPT presentation | free to view

Macromolecular structure - SCOP (Stuctural Classification Of Proteins) Structure classification. ... CATH: structural classification of proteins, [http://www.biochem.ucl.ac.uk/bsm/cath ...

SCOP (Stuctural Classification Of Proteins) Structure classification. ... CATH: structural classification of proteins, [http://www.biochem.ucl.ac.uk/bsm/cath ...

| PowerPoint PPT presentation | free to view

Protein Structural Prediction - Protein Structural Prediction

Protein Structural Prediction

| PowerPoint PPT presentation | free to download

Protein Structure - Test an array of conditions to determine which give good quality crystals. ... Compute atom locations (C, N, O, S) Relax structure computationally ... Rosetta ...

Test an array of conditions to determine which give good quality crystals. ... Compute atom locations (C, N, O, S) Relax structure computationally ... Rosetta ...

| PowerPoint PPT presentation | free to view

Protein structure collagen PowerPoint PPT Presentation

Protein structure collagen - BIOCHEMISTRY

BIOCHEMISTRY

| PowerPoint PPT presentation | free to download

Protein structure determination PowerPoint PPT Presentation

Protein structure determination - Protein structure determination X-ray crystallography http://en.wikipedia.org/wiki/X-ray_diffraction Nuclear magnetic resonance spectroscopy Protein structure ...

Protein structure determination X-ray crystallography http://en.wikipedia.org/wiki/X-ray_diffraction Nuclear magnetic resonance spectroscopy Protein structure ...

| PowerPoint PPT presentation | free to download

Structure of Proteins PowerPoint PPT Presentation

Structure of Proteins - ... abnormal bone formation in babies Ehlers-Danlos syndrome - loose joints Both diseases involve: ... H-bonds between different sheets Made by: ...

... abnormal bone formation in babies Ehlers-Danlos syndrome - loose joints Both diseases involve: ... H-bonds between different sheets Made by: ...

| PowerPoint PPT presentation | free to view

Protein structure prediction - PSI-PRED secondary structure prediction based on PSIBLAST ... Strand(E), Helix(H) and Coil(C) AA: RLMPHIKRSAIPVNHGQCRWEDNVDERTNCMIQYVLIMRD ...

PSI-PRED secondary structure prediction based on PSIBLAST ... Strand(E), Helix(H) and Coil(C) AA: RLMPHIKRSAIPVNHGQCRWEDNVDERTNCMIQYVLIMRD ...

| PowerPoint PPT presentation | free to download

RNA secondary structure PowerPoint PPT Presentation

RNA secondary structure - Case 4: Bifurcation. combining two optimal substructures i, k and k 1, j. k ... pushdown stack is used to deal with bifurcated structures. Traceback Pseudocode ...

Case 4: Bifurcation. combining two optimal substructures i, k and k 1, j. k ... pushdown stack is used to deal with bifurcated structures. Traceback Pseudocode ...

| PowerPoint PPT presentation | free to download

Protein structural element PowerPoint PPT Presentation

Protein structural element - Protein structural element. Yun-Ru (Ruby) Chen ??? Ph.D. The ... Aliphatic. pKa=13.6. cis-trans Isomerization (trans:cis) Non-proyl (1000:1) X-proyl bond (4:1) ...

Protein structural element. Yun-Ru (Ruby) Chen ??? Ph.D. The ... Aliphatic. pKa=13.6. cis-trans Isomerization (trans:cis) Non-proyl (1000:1) X-proyl bond (4:1) ...

| PowerPoint PPT presentation | free to download

RAID Structure PowerPoint PPT Presentation

RAID Structure - ... magneto-optic disk records data on a rigid platter coated with magnetic material. ... Thin aluminum film sandwiched between two glass or plastic platters. ...

... magneto-optic disk records data on a rigid platter coated with magnetic material. ... Thin aluminum film sandwiched between two glass or plastic platters. ...

| PowerPoint PPT presentation | free to view

Proteins Secondary Structure Predictions PowerPoint PPT Presentation

Proteins Secondary Structure Predictions - Structural Bioinformatics Proteins Secondary Structure Predictions

Structural Bioinformatics Proteins Secondary Structure Predictions

| PowerPoint PPT presentation | free to view

Visualizing Protein Structures PowerPoint PPT Presentation

Visualizing Protein Structures - Title: Why teach a course in bioinformatics? Author: Jim Last modified by: jimy Created Date: 12/21/2001 7:09:20 PM Document presentation format: On-screen Show

Title: Why teach a course in bioinformatics? Author: Jim Last modified by: jimy Created Date: 12/21/2001 7:09:20 PM Document presentation format: On-screen Show

| PowerPoint PPT presentation | free to view

Proteins: Primary Structure PowerPoint PPT Presentation

Proteins: Primary Structure - Figure from The Structures of Life (NIH) Proteins are the Body's Worker Molecules ... Bovine insulin: note the intra- and inter- chain disulfide linkages ...

Figure from The Structures of Life (NIH) Proteins are the Body's Worker Molecules ... Bovine insulin: note the intra- and inter- chain disulfide linkages ...

| PowerPoint PPT presentation | free to download

Textile Structural Composites PowerPoint PPT Presentation

Textile Structural Composites - Title: TMS465 Textile Structural Composites Author: yqiu Last modified by: Yiping Created Date: 8/19/1996 8:52:25 PM Document presentation format

Title: TMS465 Textile Structural Composites Author: yqiu Last modified by: Yiping Created Date: 8/19/1996 8:52:25 PM Document presentation format

| PowerPoint PPT presentation | free to view

Structure prediction PowerPoint PPT Presentation

Structure prediction - 4 Basic Levels of Protein Structure and all information is in the sequence ... AB-INITIO methods. Simulate the process of folding ...

4 Basic Levels of Protein Structure and all information is in the sequence ... AB-INITIO methods. Simulate the process of folding ...

| PowerPoint PPT presentation | free to view

Structural Biology PowerPoint PPT Presentation

Structural Biology - 12/Dec 11:00-12:45 C2. GS NMR in Structural Biology. GS How Proteins Recognize DNA ... since they don't occur in proteins (except for the N and C termini respectively) ...

12/Dec 11:00-12:45 C2. GS NMR in Structural Biology. GS How Proteins Recognize DNA ... since they don't occur in proteins (except for the N and C termini respectively) ...

| PowerPoint PPT presentation | free to view

Protein Structure - Compute atom locations (C, N, O, S) Relax structure ... NMR: NOEs, J-coupling constants measurements give structural constraints ... GAMESS, Rosetta (Baker lab) ...

Compute atom locations (C, N, O, S) Relax structure ... NMR: NOEs, J-coupling constants measurements give structural constraints ... GAMESS, Rosetta (Baker lab) ...

| PowerPoint PPT presentation | free to view

Structural Bioinformatics 2 PowerPoint PPT Presentation

Structural Bioinformatics 2 - rate of evolution of different parts of protein structures ... sometimes 1.0 Angstrom RMSD (RMSD is the root mean square deviation between ...

rate of evolution of different parts of protein structures ... sometimes 1.0 Angstrom RMSD (RMSD is the root mean square deviation between ...

| PowerPoint PPT presentation | free to view

Principles of protein structure and stability. PowerPoint PPT Presentation

Principles of protein structure and stability. - Potential energy = Van der Waals Electrostatic ... Final specific tertiary structure is formed by van der Waals interactions, HB, disulfide bonds. ...

Potential energy = Van der Waals Electrostatic ... Final specific tertiary structure is formed by van der Waals interactions, HB, disulfide bonds. ...

| PowerPoint PPT presentation | free to download

Tertiary Structure PowerPoint PPT Presentations